SecReT4
Protein ID: 116006758
T4SS name [ID]Trb [77]
Gene symboltrbF
Locus tagST520_p26
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]16235..17017 [+]
ProductTrbF
Component typeTrbF
UniProt IDQ08KZ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-58, Aligned region: 46..258
Protein Sequence: 260 a.a.     [Download]
>gi|116006758|ref|YP_787942.1| TrbF [Bordetella pertussis]
MSIADTLKGLIFKKPANSAEPRDPRRSKEPLAGGRRAGEAENPYLAARRTWNDHVRGVVSQRQTWQVIGI
LSLLIALAGVGGVIHIGSQSKFIPYVVEVDKLGQTVAAGPVQAAGKADPRVIHAAVADWMSCARMVSPDV
ALQRKCVFKVYSMLAPNDPATPKMNEWLNGTPDSSPFKRAEKEMVSVEIKTVIPQTPDTWQVEWVETTRD
RQGTLKSQPVTWRALVTTYIAEVTPNTTDEQLRNNPLSIYVRDYSWSRIQ
 
Nucleotide Sequence: 783 bp     [Download]
>gi|116006736|ref|NC_008459.1|:16235-17017 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGAGCATCGCCGACACCCTCAAGGGCTTGATCTTCAAGAAGCCCGCCAACTCCGCCGAGCCGCGCGATC
CGCGCCGCTCGAAGGAACCGCTCGCCGGCGGCCGCCGTGCGGGCGAGGCCGAGAACCCCTACCTGGCCGC
GCGCCGCACCTGGAACGATCACGTGCGCGGCGTCGTCTCGCAGCGCCAAACCTGGCAGGTGATCGGCATC
CTGTCGCTGTTGATCGCGCTGGCCGGCGTGGGTGGCGTGATCCACATCGGCAGCCAGTCGAAGTTCATCC
CCTACGTGGTCGAGGTGGACAAGCTGGGCCAGACGGTGGCCGCCGGCCCGGTACAGGCCGCAGGGAAGGC
CGATCCGCGTGTCATCCACGCCGCCGTTGCGGACTGGATGAGCTGCGCGCGCATGGTGTCGCCTGACGTG
GCCTTGCAGCGCAAGTGCGTGTTCAAGGTGTACTCGATGCTCGCCCCCAACGATCCGGCGACGCCAAAGA
TGAACGAGTGGTTGAACGGCACGCCCGATTCCAGCCCGTTCAAGCGCGCCGAGAAGGAAATGGTCAGCGT
CGAGATCAAGACCGTCATCCCGCAAACGCCCGACACCTGGCAAGTCGAGTGGGTGGAAACCACGCGCGAC
CGCCAAGGCACGCTGAAAAGTCAGCCCGTCACCTGGCGCGCGCTCGTGACTACCTACATCGCCGAGGTCA
CGCCCAACACCACCGATGAGCAACTGCGGAACAACCCGTTGAGCATCTACGTGCGTGATTACTCCTGGTC
CCGCATCCAATGA
 Primer design