SecReT4
Protein ID: 116006759
T4SS name [ID]Trb [77]
Gene symboltrbG
Locus tagST520_p25
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]17014..17934 [+]
ProductTrbG
Component typeTrbG
UniProt IDQ08KZ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.2e-66, Aligned region: 80..305
Protein Sequence: 306 a.a.     [Download]
>gi|116006759|ref|YP_787943.1| TrbG [Bordetella pertussis]
MNSRSSTMKKTLSALIVGAAVAVPSLALAAPGDDIADKYFNKTNPTLTAQERAALAIAKRWEAGSATGIK
PVAGSGGAIKFVYGAQQPSIVCAVLQVCDVALQPGEQVNSIHLGDTARWTVEPAITGSGATEVQHLIIKP
MDVGLETSLVVTTNRRSYHFRLRSHRTEYMPQVSFTYPEEAQAKWDAIQRREKQERTDNTLPATGEYLGD
LSFDYELSGSASWKPVRVYNDGRKTIIEMPGTMQQTEAPTLLVVRKEGGLFTDDETVLVNYRVQGNRYIV
DTVFDRAILIAGVGSSQDRVTISRRK
 
Nucleotide Sequence: 921 bp     [Download]
>gi|116006736|ref|NC_008459.1|:17014-17934 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGAATTCGAGGTCATCCACCATGAAGAAAACCCTCTCCGCTTTGATCGTGGGCGCTGCTGTGGCGGTGC
CCTCCCTGGCCCTGGCCGCCCCTGGCGACGACATTGCCGACAAGTATTTCAACAAGACCAACCCGACGCT
GACCGCTCAAGAGCGCGCGGCGCTCGCCATCGCCAAACGGTGGGAAGCGGGGTCGGCGACCGGCATCAAG
CCGGTGGCCGGCTCAGGCGGTGCCATCAAGTTCGTGTACGGCGCGCAGCAGCCGAGCATCGTTTGCGCGG
TGCTCCAGGTGTGCGACGTGGCCTTGCAGCCCGGCGAACAAGTGAACTCGATCCACCTGGGCGACACGGC
CAGGTGGACGGTGGAACCGGCCATCACCGGCAGCGGCGCGACCGAGGTTCAGCACCTCATCATCAAGCCG
ATGGACGTGGGCCTCGAAACCAGCCTGGTTGTGACCACGAACCGCCGCAGCTACCACTTCCGCCTGCGCT
CGCATCGCACCGAGTACATGCCGCAAGTCTCGTTCACGTACCCCGAGGAAGCGCAAGCCAAGTGGGACGC
GATCCAGCGCCGCGAGAAGCAGGAACGCACCGACAACACCCTGCCGGCGACGGGCGAGTACCTGGGCGAT
CTCTCGTTCGACTATGAGCTGTCCGGGTCGGCGAGCTGGAAGCCTGTGCGCGTCTACAACGATGGCCGCA
AGACCATCATCGAAATGCCCGGCACGATGCAGCAGACCGAAGCGCCGACGCTCCTGGTCGTGCGCAAAGA
GGGCGGCTTGTTCACCGACGACGAAACGGTGCTGGTCAATTACCGCGTGCAGGGCAATCGCTACATCGTG
GACACGGTGTTTGACCGCGCGATCCTGATTGCCGGTGTTGGCAGTAGCCAAGACCGCGTGACCATCAGCC
GGAGGAAGTGA
 Primer design