SecReT4
Protein ID: 116006760
T4SS name [ID]Trb [77]
Gene symboltrbH
Locus tagST520_p24
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]17937..18401 [+]
ProductTrbH
Component typeTrbH
UniProt IDQ08KZ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 1.2e-49, Aligned region: 33..154
Protein Sequence: 154 a.a.     [Download]
>gi|116006760|ref|YP_787944.1| TrbH [Bordetella pertussis]
MRKIVSLALLALALGLGGCATTSQYGNFVQSAALDQQKLAADAVQQLAMLYAPARTRLELQQPTPDPFGQ
ALVKSLRDKGYALLEYAPAGASTQASAPATTAALGGLPLRYVLDQAGDSNLYRLTLMVGNQSITRPYLAQ
NGTFAPAGYWVRKE
 
Nucleotide Sequence: 465 bp     [Download]
>gi|116006736|ref|NC_008459.1|:17937-18401 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGCGCAAGATCGTCTCTCTCGCGCTGCTCGCCCTCGCCCTGGGCCTCGGCGGCTGCGCAACCACCAGCC
AGTACGGCAACTTCGTCCAGTCGGCCGCGCTCGATCAGCAGAAGCTCGCCGCCGACGCGGTGCAGCAGCT
CGCCATGCTGTACGCGCCGGCGCGCACGCGCCTGGAGCTGCAACAGCCGACGCCCGATCCGTTCGGCCAG
GCGCTCGTCAAGTCGCTGCGCGACAAGGGCTATGCCCTCCTGGAGTACGCCCCGGCCGGCGCTTCCACGC
AGGCGAGCGCACCGGCCACCACGGCCGCGTTGGGCGGCCTGCCGTTGCGCTACGTGCTCGACCAGGCTGG
CGACTCGAACCTGTACCGCCTGACCTTGATGGTCGGCAATCAATCCATCACCCGCCCTTACCTGGCGCAA
AACGGCACGTTCGCCCCGGCCGGGTACTGGGTGCGCAAGGAGTGA
 Primer design