SecReT4
Protein ID: 116006761
T4SS name [ID]Trb [77]
Gene symbolTrbI
Locus tagST520_p23
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]18406..19818 [+]
ProducttrbI
Component typeTrbI
UniProt IDQ08KZ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-65, Aligned region: 276..461
Protein Sequence: 470 a.a.     [Download]
>gi|116006761|ref|YP_787945.1| trbI [Bordetella pertussis]
MTENADQMAPDASPGEVSKKAGVRRVNNMPMYILGGVLLSFVLVMALVAADRAAKQNAPVEGPKEKAGNT
SMFAKEIAGDKTSGLIEPARPLQVPDMPTDPASAPLEIARPSNPDAPPLPPANPGNPVNDDEAQRIRMAK
MQMFGEAVKAKTTVRVDAPRSNGSAPGGPSTYTGTPQTRDEMLNRIAAVQQQIDAQRSNDPTAAYQARLA
QIRGMGVGGGGAAPAAGGMGAGGAPQLLQTSTSSGGRNSMAQFGQGGQGDRWKLDSQPEAPRTPFELRAG
FVVPATLISGINSDLPGQIMAQVAQDVYDTPTGKHLLIPQGSRLVGSYSSDVAYGQARVLVAWQRIVFPD
GKAMDIGAMPGADSAGYAGFHDQVNNHYVRLFGSAFLMSGVTAGITYSQRQNQATNTYGAPSASSALSEA
LGQQLGQVTAQLIAKNLSISPTLEIRPGYRFNVVVTKDMTFSKPYRSFDY
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|116006736|ref|NC_008459.1|:18406-19818 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGACAGAAAACGCCGATCAGATGGCACCTGACGCTTCGCCTGGCGAAGTGTCCAAGAAGGCGGGCGTCC
GTCGCGTCAACAACATGCCCATGTACATCCTCGGCGGCGTCCTGCTGTCGTTCGTGCTGGTCATGGCCCT
GGTCGCGGCGGATCGCGCAGCCAAGCAGAACGCACCGGTAGAAGGCCCGAAGGAGAAAGCAGGCAACACG
TCGATGTTCGCCAAGGAGATCGCGGGCGACAAGACCAGCGGCCTAATCGAACCGGCACGCCCGCTCCAGG
TGCCCGACATGCCGACCGACCCGGCGTCGGCCCCGCTGGAGATCGCGCGGCCGTCCAACCCGGACGCGCC
GCCGCTACCGCCAGCCAACCCCGGCAACCCGGTGAACGACGACGAGGCCCAGCGCATCCGCATGGCGAAG
ATGCAGATGTTCGGCGAAGCCGTGAAGGCCAAGACCACCGTGCGCGTGGATGCCCCGCGTAGCAACGGCT
CCGCGCCGGGTGGCCCGAGCACCTACACCGGCACGCCGCAGACGCGCGATGAGATGCTGAACCGCATCGC
AGCGGTGCAGCAGCAAATCGACGCGCAGCGCAGCAACGATCCGACCGCCGCCTATCAAGCACGCCTGGCG
CAGATTCGCGGCATGGGCGTCGGTGGTGGCGGCGCGGCTCCGGCCGCCGGCGGCATGGGCGCGGGCGGTG
CGCCGCAGCTCCTGCAAACCTCGACCAGCAGCGGCGGCCGCAACAGCATGGCGCAGTTCGGCCAGGGTGG
GCAGGGCGACCGCTGGAAGCTGGATTCGCAGCCGGAAGCGCCGCGCACGCCGTTCGAGCTGCGCGCGGGC
TTCGTCGTGCCGGCCACGCTCATTTCGGGCATCAACTCCGATCTGCCGGGCCAAATCATGGCCCAGGTCG
CGCAGGACGTATACGACACGCCGACCGGCAAGCATCTGTTGATTCCGCAGGGCTCGCGCCTTGTCGGCTC
CTATTCGAGCGATGTGGCCTACGGCCAGGCCCGCGTGCTGGTTGCGTGGCAGCGCATCGTGTTCCCCGAT
GGCAAGGCGATGGACATTGGCGCGATGCCAGGCGCGGACAGCGCGGGATACGCGGGCTTCCACGACCAGG
TGAACAACCACTATGTGCGCCTGTTCGGCTCGGCCTTCCTCATGTCCGGCGTGACGGCTGGCATCACCTA
CAGCCAACGCCAGAACCAGGCCACAAACACCTATGGCGCACCGAGCGCCAGCAGTGCCCTAAGCGAAGCC
CTCGGCCAGCAGCTCGGCCAGGTTACGGCGCAACTCATCGCCAAGAACCTGAGCATTTCGCCGACGCTGG
AAATTCGGCCGGGGTATCGCTTCAACGTCGTGGTCACGAAGGACATGACGTTTTCAAAGCCGTACCGTTC
CTTCGATTACTAA
 Primer design