SecReT4
Protein ID: 116006762
T4SS name [ID]Trb [77]
Gene symboltrbJ
Locus tagST520_p22
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]19839..20603 [+]
ProductTrbJ
Component typeTrbJ
UniProt IDQ08KZ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 7.4e-06, Aligned region: 28..192
Protein Sequence: 254 a.a.     [Download]
>gi|116006762|ref|YP_787946.1| TrbJ [Bordetella pertussis]
MKPKFLAAKLALVIAVSSTLAVTPVQAGIPVIDGTNLSQNIMTAIESVAQTLKQIEQYRTQLQQYENMLQ
NTMAPAAYIWDQAQSTINGLMNAVNTLDYYRNQLGSLDAYLGKFQDVSYYRSSPCFSAAGCSDAERAAME
QNRRLASESQKKANDALFKGLEQQQRNLTADARQLEQLQSAAQGATGQMQAISFANQLASQQANQLLQIR
GLLIAQQNAMATKMQADADKEAQQAAAAAQLRQGSYRASPARTW
 
Nucleotide Sequence: 765 bp     [Download]
>gi|116006736|ref|NC_008459.1|:19839-20603 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGAAGCCGAAGTTTTTAGCCGCTAAATTGGCCCTCGTCATTGCTGTTTCGAGCACGCTGGCGGTCACAC
CTGTGCAGGCGGGCATCCCCGTCATCGACGGCACCAACCTGTCGCAGAACATCATGACGGCCATCGAATC
GGTGGCCCAGACGCTCAAGCAGATCGAGCAATACCGGACGCAGTTGCAGCAGTACGAAAACATGCTGCAA
AACACGATGGCCCCGGCGGCCTACATCTGGGATCAGGCGCAGTCCACGATCAACGGGCTGATGAACGCCG
TTAACACGCTGGACTACTACAGGAACCAGCTCGGTAGTCTTGATGCCTACCTGGGCAAATTCCAGGATGT
GAGCTACTACCGCAGCTCGCCGTGCTTCTCGGCCGCCGGGTGCTCGGACGCCGAGCGCGCTGCGATGGAG
CAAAACCGCCGCCTGGCGAGCGAGAGCCAGAAGAAGGCGAACGACGCGCTTTTCAAGGGTCTGGAGCAGC
AGCAGCGCAACCTTACCGCCGACGCTCGCCAGCTCGAACAGCTCCAGTCGGCCGCACAAGGCGCGACCGG
CCAGATGCAGGCTATCAGCTTCGCCAACCAGCTCGCCAGCCAGCAGGCCAACCAGCTCTTGCAGATTCGT
GGCCTGCTGATCGCGCAGCAGAACGCGATGGCAACCAAGATGCAGGCCGACGCCGACAAGGAAGCCCAGC
AGGCGGCAGCGGCCGCACAACTGCGCCAGGGCAGCTACCGGGCCAGCCCGGCGCGCACCTGGTAA
 Primer design