SecReT4
Protein ID: 116006763
T4SS name [ID]Trb [77]
Gene symboltrbK
Locus tagST520_p21
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]20613..20840 [+]
ProductTrbK
Component typeTrbK
UniProt IDQ08KZ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|116006763|ref|YP_787947.1| TrbK [Bordetella pertussis]
MKAIKALSLASAALVAALVAGCDNKPATAPMPEVNDENCKPENIAKIEDKGVQQAFSSLCLRRGGDFKPS
PKREW
 
Nucleotide Sequence: 228 bp     [Download]
>gi|116006736|ref|NC_008459.1|:20613-20840 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGAAAGCAATCAAGGCTCTGTCCTTGGCCTCGGCCGCCCTCGTGGCGGCCCTGGTCGCCGGCTGCGACA
ACAAGCCGGCCACGGCCCCCATGCCGGAGGTGAACGACGAGAACTGCAAGCCCGAGAACATCGCCAAGAT
CGAGGACAAGGGGGTCCAGCAGGCTTTCTCGTCGCTGTGCTTGCGTCGTGGTGGGGATTTCAAGCCCAGC
CCAAAACGCGAATGGTGA
 Primer design