SecReT4
Protein ID: 116006764
T4SS name [ID]Trb [77]
Gene symboltrbL
Locus tagST520_p20
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]20851..22440 [+]
ProductTrbL
Component typeTrbL
UniProt IDQ08KZ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-38, Aligned region: 65..279
Protein Sequence: 529 a.a.     [Download]
>gi|116006764|ref|YP_787948.1| TrbL [Bordetella pertussis]
MRMPANLKTLALPLFVWLAFFAVDAHAAIDNAGVFDSVLDRYQSAASGWAGVITTAATWLFWTLVVISMV
WTFGMMALRKADIGEFFAEFVRFTIFTGFFWWALTNGPNFASSIYASLRQLAGNATGLGNALSPSGIVDV
GFAIFDKVMDQSSVWSPVDSMAGILMAVAILVILALVGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKVVLGVAAQLFAMVLLVGIGKTFLDDYYSRMSAGISLKEMGVMLIVVIILLALVNKIPPLIAGII
TGASVGGAGIGQFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSAGTDVMSA
FSGGGSSGGGAGGGDAGTGNTPFAQAAGFSGSSGGGSSSGGGSPSTGSSSGSSKGGGKADAGGAGQGQQG
GQQAAPGRTGPGLLASAASALGTAGASPPTPARTWRREPPMLPRPRPRACAKQPPNGSPKPPAERSPPRS
RRKEAARPRTSTCPTSSPRRASATTAWQAAPPMPIPSPK
 
Nucleotide Sequence: 1590 bp     [Download]
>gi|116006736|ref|NC_008459.1|:20851-22440 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGAGAATGCCAGCCAATCTAAAAACCCTCGCCCTGCCGCTGTTCGTCTGGCTGGCGTTCTTCGCGGTCG
ATGCCCACGCGGCCATCGACAACGCCGGCGTGTTCGATAGCGTGCTGGATCGCTACCAGTCCGCAGCGAG
CGGCTGGGCCGGTGTCATCACCACGGCCGCAACCTGGCTCTTCTGGACGCTGGTTGTGATCTCGATGGTC
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGGGAGTTCTTCGCGGAGTTCGTCCGCTTCA
CGATCTTTACCGGCTTCTTCTGGTGGGCGCTGACCAACGGCCCTAACTTCGCCTCGTCCATCTATGCGTC
GTTGCGGCAGCTCGCCGGCAACGCGACGGGCCTGGGCAATGCGCTGTCGCCCTCGGGGATCGTGGACGTG
GGCTTTGCAATCTTCGACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TCCTCATGGCCGTGGCGATCCTAGTCATCCTGGCCCTGGTTGGTGTCAACATGCTTCTGCTGCTCGCGTC
GGGCTGGGTGCTCGCCTACGGCGGCGTGTTCTTCCTCGGCTTCGGCGGTTCGCGCTGGACTTCCGACATG
GCGATCAACTACTACAAGGTCGTCCTGGGCGTGGCCGCGCAGCTCTTCGCAATGGTGCTCCTGGTGGGCA
TCGGCAAGACCTTCCTCGATGACTACTACTCGCGCATGAGCGCCGGCATCAGCCTCAAGGAAATGGGCGT
GATGCTGATCGTCGTCATCATCCTCTTGGCGTTGGTCAACAAGATTCCGCCGCTCATCGCCGGGATCATC
ACCGGCGCTAGCGTTGGCGGTGCCGGCATCGGCCAGTTCGGTGCAGGCGCTGCGCTGGGTGCCGCAGGCA
TGGCAGCAGCAGCGGCGGCGACCGGCGGCGCTGCTCTGGCCGCCGGCGCAGCCTCGGCCGCCGGCGGTGC
CTCTGCTGTCATGGCTGCCTTCTCGAAGGCCAATGAAAACGTGTCGGCAGGCACGGACGTTATGTCGGCC
TTCTCGGGCGGCGGCAGCTCGGGCGGCGGTGCAGGCGGCGGCGACGCCGGCACCGGCAACACGCCCTTCG
CTCAGGCTGCGGGCTTTAGCGGCAGCTCCGGCGGTGGCTCTTCTTCGGGTGGCGGCAGCCCCTCGACCGG
CAGCAGCTCGGGCAGCTCGAAGGGCGGCGGCAAAGCCGACGCCGGCGGGGCAGGGCAGGGGCAACAGGGC
GGCCAGCAGGCCGCACCGGGCAGAACCGGCCCCGGCCTGCTCGCATCGGCCGCCTCGGCGCTCGGCACGG
CCGGCGCATCGCCGCCGACGCCGGCGCGAACTTGGCGAAGGGAACCGCCGATGTTGCCAAGGCCAAGGCC
GCGAGCCTGCGCGAAGCAGCCGCCGAACGGATCGCCGAAACCACCGGCGGAAAGATCGCCGCCGCGATCA
AGGCGCAAGGAAGCGGCACGGCCGAGAACATCGACGTGCCCGACCAGCAGCCCGCGCCGAGCTTCGGCGA
CAACAGCCTGGCAGGCGGCGCCGCCGATGCCGATCCCGAGTCCGAAGTAG
 Primer design