SecReT4
Protein ID: 116006766
T4SS name [ID]Trb [77]
Gene symboltrbN
Locus tagST520_p18
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]23106..23741 [+]
ProductTrbN
Component typeTrbN
UniProt IDQ08KY9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 211 a.a.     [Download]
>gi|116006766|ref|YP_787950.1| TrbN [Bordetella pertussis]
MPFFADLPPQLQERVVCSISAAVKYEVPVNIVLAVAEKEGGKPGQWVRNSNGTHDVGPMQFNTAYLGDLA
RYGITANDVAAAGCYSFDLAAWRLRMHIRNDKGDLWTKAANYHSRTPQYNAVYRADLMRKASKWADWLEA
RFVTLDVTKAGATPSTPSPPATVAQRATPAARPAPAPQQAAPAAAAARSVSMAGYVPRTVSFNTSREGSA
E
 
Nucleotide Sequence: 636 bp     [Download]
>gi|116006736|ref|NC_008459.1|:23106-23741 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGCCATTCTTCGCCGATCTGCCGCCGCAGCTCCAGGAGCGCGTCGTCTGCTCGATCTCGGCCGCCGTCA
AGTACGAGGTGCCGGTCAACATCGTGTTGGCCGTCGCCGAGAAAGAGGGTGGCAAACCGGGCCAGTGGGT
GCGCAACTCGAATGGCACGCATGACGTTGGCCCGATGCAGTTCAACACCGCGTACCTGGGCGACCTGGCC
CGATACGGCATCACGGCGAACGATGTGGCGGCTGCCGGCTGCTACTCGTTCGACCTGGCCGCCTGGCGGC
TGCGGATGCACATCCGCAACGACAAGGGCGACCTCTGGACGAAGGCGGCGAACTACCACTCGCGCACGCC
GCAGTACAACGCGGTGTACCGGGCCGACTTGATGCGCAAGGCGTCGAAGTGGGCCGATTGGCTCGAAGCT
CGGTTCGTCACGCTTGACGTGACGAAGGCCGGGGCCACGCCCTCGACGCCCAGCCCGCCCGCGACGGTGG
CCCAGCGGGCGACGCCGGCGGCTAGGCCGGCACCAGCACCCCAGCAGGCCGCCCCAGCGGCCGCAGCAGC
TCGCAGCGTGTCGATGGCCGGCTACGTGCCCCGCACGGTGTCTTTCAACACTTCACGCGAGGGGTCGGCC
GAGTAG
 Primer design