SecReT4
Protein ID: 116006775
T4SS name [ID]Trb [77]
Gene symboltraF
Locus tagST520_p39
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]34236..34772 [-]
ProductTraF
Component typeTraF
UniProt IDQ08KY0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 5.1e-46, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|116006775|ref|YP_787959.1| TraF [Bordetella pertussis]
MSRILKRIAAGVAIAGVAALLLAAGGYAAGARVNTTKSIPVGLYWTSSAPVEKGAYVLFCPPQLGVFDDA
KERGYIGAGFCQGGYGYMMKRVLAAKGDAVAVADDGVRVNGELLPLSAPIKADKAGRPLPRYQSSSYTLG
NSEVLLMSDVSATSFDGRYFGPINRSQIKTVIRPVITW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|116006736|ref|NC_008459.1|:c34772-34236 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGAGCCGCATCCTGAAACGCATCGCGGCAGGCGTCGCCATCGCGGGCGTGGCTGCCCTGCTGTTGGCCG
CCGGCGGCTATGCCGCCGGTGCCCGCGTGAACACCACCAAGAGCATTCCGGTCGGCCTGTACTGGACGAG
CAGCGCGCCGGTGGAGAAGGGGGCCTACGTCCTCTTCTGCCCGCCGCAGCTCGGCGTGTTCGACGACGCC
AAGGAAAGGGGCTACATCGGGGCCGGCTTCTGCCAGGGCGGCTACGGCTACATGATGAAGCGCGTTTTAG
CCGCTAAAGGCGATGCCGTGGCCGTCGCCGATGACGGCGTGCGCGTCAACGGCGAGCTGCTGCCCCTCAG
CGCGCCGATCAAGGCCGACAAGGCCGGGCGGCCGCTGCCGCGCTACCAGTCCAGCAGCTACACGCTCGGC
AATTCCGAGGTGCTGCTTATGTCGGACGTGAGCGCCACATCCTTCGATGGCCGCTACTTCGGCCCGATCA
ATCGTTCGCAAATCAAGACCGTGATCCGCCCGGTCATCACCTGGTAG
 Primer design