SecReT4
Protein ID: 116006776
T4SS name [ID]Trb [77]
Gene symboltraG
Locus tagST520_p40
StrainBordetella pertussis plasmid pBP136 (NC_008459)
Repliconplasmid pBP136 [GenBank: NC_008459] [Browse all T4SS(s) in this replicon]
Location [Strand]34769..36682 [-]
ProductTraG
Component typeTraG
UniProt IDQ08KX9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.9e-161, Aligned region: 121..620
TraG-D_C [PF12696], Evalue: 4.1e-32, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 6.1e-26, Aligned region: 195..568
Protein Sequence: 637 a.a.     [Download]
>gi|116006776|ref|YP_787960.1| TraG [Bordetella pertussis]
MKIKMNNAVGPQVRAAKPKPSKLLPVLGAASIVGGLQAATQFFAHTFAYHATLGPNVGHVYAPWSILHWT
YKWYSQYPDEIMKAGSMGMLVSTVGLLGVAVAKVVTSNSSKANEYLHGSARWAEKKDIQAAGLLPRERNF
LEIVTGRAAPTATGVYVGGWQDKDGNFYYLRHSGPEHVLTYAPTRSGKGVGLVVPTLLSWSPSCVITDLK
GELWALTAGWRQKHAKNKVLRFEPASTSGGVCWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLDSHWQ
KTAFALLVGVILHALYKAKDEGGTATLPSVDAMLADPNRDIGELWMEMATYGHVDGQNHHAIGSAARDMM
DRPEEEAGSVLSTAKSYLALYRDPVVARNVSRSDFRIKQLMHEDDPVSLYIVTQPNDKARLRPLVRVMVN
MIVRLLADKMDFEGGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQDINQLKSRET
GYGPDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRTAAMLGQVSRTYQEVQRPLLT
PDECLRMPGPKKNAQGEIEEAGDMVIYVAGYPAIYGKQPLYFKDPVFSARAAIPAPKVSDRLRAVAQAET
EGERITI
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|116006736|ref|NC_008459.1|:c36682-34769 Bordetella pertussis plasmid pBP136 DNA, complete sequence
ATGAAGATCAAGATGAACAACGCGGTAGGGCCGCAAGTCCGAGCCGCCAAACCGAAGCCGAGCAAGCTGC
TGCCGGTGCTGGGCGCGGCCTCGATCGTCGGCGGCCTTCAGGCCGCGACGCAGTTCTTCGCCCACACGTT
CGCCTATCACGCGACCCTCGGCCCCAACGTGGGCCACGTGTACGCGCCCTGGTCGATCCTGCACTGGACG
TACAAGTGGTACAGCCAGTACCCGGACGAGATCATGAAGGCCGGCAGCATGGGGATGCTGGTTTCGACCG
TGGGGCTGCTGGGCGTGGCCGTGGCGAAGGTCGTCACGTCCAACAGCTCGAAGGCGAACGAGTACCTGCA
CGGCTCGGCCCGCTGGGCCGAGAAGAAGGACATTCAGGCGGCCGGCCTGCTGCCGCGCGAGCGCAACTTC
CTGGAGATCGTCACCGGCAGGGCCGCACCCACGGCCACCGGCGTGTACGTGGGCGGCTGGCAGGACAAGG
ACGGCAATTTCTACTACCTGCGGCACAGCGGCCCCGAGCACGTGCTTACCTATGCGCCTACCCGGTCGGG
TAAGGGTGTTGGCCTGGTGGTGCCCACGCTTCTTTCCTGGTCGCCAAGCTGCGTCATTACCGACTTGAAG
GGCGAGTTGTGGGCCTTGACCGCCGGCTGGCGGCAGAAGCACGCCAAGAACAAGGTGCTGCGCTTCGAGC
CGGCCAGCACCTCGGGCGGCGTCTGCTGGAATCCGCTGGACGAAATCCGCCTCGGCACCGAATACGAAGT
GGGCGACGTGCAGAACCTTGCCACGCTGATCGTTGACCCGGACGGCAAGGGCCTGGACTCGCACTGGCAG
AAGACCGCCTTCGCGCTCCTGGTCGGCGTGATCCTGCACGCGCTGTACAAGGCCAAGGACGAGGGCGGCA
CCGCCACGCTGCCGTCCGTCGATGCGATGCTGGCCGACCCGAACCGGGACATTGGCGAGCTTTGGATGGA
AATGGCGACCTACGGGCACGTAGACGGCCAGAACCATCACGCCATCGGCTCGGCGGCACGCGACATGATG
GATCGGCCAGAGGAAGAAGCCGGATCGGTGCTGTCCACGGCCAAGTCGTACCTGGCCCTGTACCGCGACC
CCGTGGTGGCGCGCAACGTCAGCCGGTCGGACTTCCGCATCAAGCAGTTGATGCACGAGGACGACCCGGT
AAGCCTCTACATCGTCACCCAGCCCAACGACAAGGCCCGCCTGCGGCCGCTGGTGCGCGTCATGGTGAAC
ATGATCGTGCGCCTGCTGGCCGACAAGATGGACTTCGAGGGCGGCCGTCCGGTGGCGCACTACAAGCACC
GGCTCTTGATGATGCTGGACGAGTTCCCGAGCCTCGGGAAGCTGGAGATCATGCAAGAGTCGCTGGCCTT
CGTGGCCGGCTACGGCATCAAGTGCTACCTCATCTGCCAGGACATTAACCAGCTCAAGAGCCGCGAGACG
GGCTACGGCCCCGACGAAAGCATCACGTCGAACTGCCACGTGCAGAACGCCTATCCGCCCAACCGCGTCG
AGACGGCCGAACACCTGTCCCGCCTCACCGGGCAGACCACCGTGGTGAAGGAGCAGATCACGACCAGCGG
CCGACGCACGGCGGCGATGCTGGGCCAGGTGTCGCGCACTTACCAGGAAGTGCAGCGGCCCTTGCTGACG
CCCGACGAATGCCTGCGCATGCCGGGGCCAAAGAAGAACGCCCAGGGCGAGATCGAAGAAGCCGGCGACA
TGGTGATCTACGTCGCGGGCTACCCGGCGATCTACGGCAAGCAACCCCTGTACTTCAAAGACCCGGTGTT
CTCGGCACGCGCCGCGATTCCCGCGCCCAAGGTCAGCGACCGCCTGCGCGCCGTCGCACAGGCCGAGACG
GAAGGGGAGCGCATCACGATATGA
 Primer design