SecReT4
Protein ID: 116006896
T4SS name [ID]Tra_F [100]
Gene symboltraF
Locus tagpO86A1_p113
StrainEscherichia coli plasmid pO86A1 (NC_008460)
Repliconplasmid pO86A1 [GenBank: NC_008460] [Browse all T4SS(s) in this replicon]
Location [Strand]79977..80720 [+]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ08JF5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.5e-78, Aligned region: 23..237
Protein Sequence: 247 a.a.     [Download]
>gi|116006896|ref|YP_788079.1| conjugal pilus assembly protein TraF [Escherichia coli]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKISPKEKENKPVPAAPRQEPDIMQKLAALQTATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKL
AEHYGIIFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|116006783|ref|NC_008460.1|:79977-80720 Escherichia coli plasmid pO86A1, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGGAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAGTCCAAAGGAAAAAGAAAATAAACCTGTACCTGCAGCCCCCCGTCA
GGAGCCGGATATTATGCAGAAACTAGCCGCGCTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCCATT
CTGTATCCCGGCGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACTCAGCAGGCCGGGC
TTTTCACCATGAGTGCTAAAAAGGCCATGCTGGCACATCCCGAACTGGACTATAACCTGCAGTACAGCCA
TTACAACGGCACGGTACGGAACCAGCTGGCGGCAGACCAGGCGCAGCAGCGACAGGCCATTGCGAAACTG
GCTGAACACTACGGCATCATTTTTTTTTACCGGGGGCAGGACCCCATCGACGGGCAGCTGGCGCAGGTCA
TTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCGCT
GTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGCGTGAAATATTTCCCGGCCATGATG
CTGGTTGACCCGAAACAGGGCAGTGTTCGTCCGTTATCATACGGTTTTATTTCGCAGGACGACCTGGCAA
AACAGTTCCTGAACGTTTCTGAAGATTTTAAACCAAATTTTTAA
 Primer design