SecReT4
Protein ID: 116006898
T4SS name [ID]Tra_F [100]
Gene symboltraQ
Locus tagpO86A1_p115
StrainEscherichia coli plasmid pO86A1 (NC_008460)
Repliconplasmid pO86A1 [GenBank: NC_008460] [Browse all T4SS(s) in this replicon]
Location [Strand]81202..81486 [+]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ08JF3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1e-49, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|116006898|ref|YP_788081.1| conjugal transfer pilin chaperone TraQ [Escherichia coli]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYLVLDAWIARVSRE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|116006783|ref|NC_008460.1|:81202-81486 Escherichia coli plasmid pO86A1, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGGG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGCTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCTGGTGCTGGATGCATGGATTGCCCGTGTCAGCCGGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design