SecReT4
Protein ID: 116006909
T4SS name [ID]Tra_F [100]
Gene symboltraX
Locus tagpO86A1_p126
StrainEscherichia coli plasmid pO86A1 (NC_008460)
Repliconplasmid pO86A1 [GenBank: NC_008460] [Browse all T4SS(s) in this replicon]
Location [Strand]96581..97327 [+]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDQ08JE2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.7e-52, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|116006909|ref|YP_788092.1| conjugal transfer pilus acetylation protein TraX [Escherichia coli]
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRAERLALVACLLAVIPALNLATSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|116006783|ref|NC_008460.1|:96581-97327 Escherichia coli plasmid pO86A1, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGT
CATTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCACTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCATATTATCTGGCAGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATTCTTCTGATGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCAGTCAGCCACCGGCTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGGTCGCCTGCCTGCT
GGCTGTTATTCCGGCGCTTAACCTTGCCACCAGTGATGCAGCGGCGGTGGCTGGTCTTGTGATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGG
TATTCTACGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGCTGTGA
 Primer design