SecReT4
Protein ID: 116050549
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_30930
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2686568..2686960 [-]
ProductTrbC-like protein
Component typeTrbC
UniProt IDQ02N54
KEGG IDpau:PA14_30930
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.5e-25, Aligned region: 29..120
Protein Sequence: 130 a.a.     [Download]
>gi|116050549|ref|YP_790632.1| trbC gene product [Pseudomonas aeruginosa UCBPP-PA14]
MTQMIVPAFRFSANPALRLPARSRLHRLARPAAQGLLLAALLLFLAGTAQAAGSSMPWEGPLQSILESIQ
GPVARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 393 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2686960-2686568 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGACGCAGATGATCGTTCCTGCTTTCCGCTTTTCTGCAAATCCGGCTTTGCGCCTTCCCGCGCGGTCGC
GGCTGCACCGCCTGGCCCGCCCTGCGGCACAAGGGCTGCTGCTGGCCGCGCTGCTGCTGTTCCTGGCCGG
AACCGCGCAGGCCGCCGGTTCCTCGATGCCATGGGAAGGCCCGCTGCAATCCATCCTCGAATCCATCCAG
GGGCCGGTGGCGCGCATTGTGGCCGTCATCATCATCATCGCCACGGGCTTGGCGCTGGCCTTCGGCGACA
CGTCGGGGGGCTTTCGCAAGCTGATCCAGATCGTGTTCGGCTTGAGCATCGCTTTCGCCGCGTCCTCGTT
CTTCCTGTCGTTCTTTTCGTTCTCTGGCGGGGCTGTCGTATGA
 Primer design