SecReT4
Protein ID: 116050551
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_30900
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2683111..2683836 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ02N56
KEGG IDpau:PA14_30900
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 6.9e-12, Aligned region: 2..37
Protein Sequence: 241 a.a.     [Download]
>gi|116050551|ref|YP_790630.1| trbJ gene product [Pseudomonas aeruginosa UCBPP-PA14]
MKKRLVAAAIAAMLCTATAHAQWVVIDPTNLVQNTLTAIRTLEQINNQIQQLQNEAQMLMNQARNLASLP
SSVVGQLRANLATTERLIAQARGLAYDVTNLDREFARLYPEQYAATVSGDQMYRDAQERWKNTLNGLQTT
MQMQAQVSQNLGEDESVLADLVGKSQSAQGALQAMQAMNQLLALQAKQSIQSQRLQITQDRAASLELARQ
AAATERAREVRRRFLGEGTPYTPQSVNFYRD
 
Nucleotide Sequence: 726 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2683836-2683111 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAAGAAGCGCCTTGTCGCCGCTGCCATCGCGGCCATGCTTTGCACCGCCACCGCCCATGCGCAATGGG
TCGTGATCGACCCCACGAACCTCGTGCAGAACACGCTGACCGCGATCCGCACGCTGGAACAGATCAACAA
CCAAATCCAGCAGCTTCAGAACGAAGCGCAGATGCTGATGAATCAGGCGCGCAACCTCGCCAGCCTGCCG
TCCAGCGTCGTCGGCCAGTTGCGCGCCAACCTGGCGACCACCGAGCGGCTGATCGCCCAAGCGCGCGGCT
TGGCCTACGACGTGACGAATCTGGATCGGGAGTTCGCGCGCCTGTACCCGGAGCAGTACGCCGCCACCGT
CAGCGGCGACCAGATGTACCGCGACGCCCAAGAGCGGTGGAAGAACACGCTCAACGGCTTGCAGACCACC
ATGCAGATGCAGGCGCAGGTGTCGCAGAACCTGGGCGAAGACGAAAGCGTGCTGGCCGATCTGGTCGGCA
AGAGCCAGTCAGCGCAAGGCGCGCTGCAAGCGATGCAGGCCATGAACCAGTTGCTCGCCTTGCAGGCCAA
GCAGTCGATCCAGTCGCAGCGGCTCCAGATCACGCAAGACCGGGCCGCCTCGCTGGAACTGGCGCGGCAG
GCGGCGGCCACCGAGCGCGCCCGCGAAGTGCGGCGGCGCTTCCTCGGGGAAGGCACGCCGTACACGCCGC
AGTCCGTCAACTTCTACCGCGACTGA
 Primer design