SecReT4
Protein ID: 116050553
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_30880
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2681412..2682782 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ02N58
KEGG IDpau:PA14_30880
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.5e-48, Aligned region: 37..264
Protein Sequence: 456 a.a.     [Download]
>gi|116050553|ref|YP_790628.1| trbL gene product [Pseudomonas aeruginosa UCBPP-PA14]
MNDVTIIDQFLNTFATYIDSGFGLLRGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIINNFNWLASIVFRSFAGLGITATGSTITMEDFLQPGRLAKAGLDAGGPIFLQLDDLMGFPEVF
LNLDAILVLFLAWLVVVLCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSAGVK
VLVLAVIVGIGSGLFAQFQVHPDEPSIDHALVIMLASLTLLALGIFGPGIATGLVSGAPQLGAGAMAGAA
IGAAGTAVAVGAAATGVGGAVAAGARMAPAAAKLAGSGARAATSAAGSAKSAFQAGSAAAGGGAKGAMAG
LGNVAKTGAQSAGRAAASRASAAGQRMAAPFRAGWKGDAGASAGQAATSEAPAGAAAAQTPEQPAWAKRL
QRRQQLTHAATTTAHTLRGGDGGGSGQGPSLRDSDS
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2682782-2681412 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAATGACGTGACGATCATCGACCAGTTCCTCAACACCTTCGCCACCTACATCGACTCGGGTTTCGGGC
TGCTGCGCGGCGAAGTGGCGTTCCTCACGGCCACGCTGATCGTCATCGACATGACGATCGCCGGGTTGTA
TTGGGCCATGAGCCATGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTGTAC
GTCGGTGCCTTCGCCTACATCATCAACAACTTCAACTGGCTGGCCAGCATCGTGTTCCGCTCGTTCGCGG
GACTGGGTATCACCGCCACCGGCTCGACTATCACGATGGAAGACTTCTTGCAGCCGGGCCGGCTGGCGAA
GGCCGGCCTTGATGCGGGCGGGCCGATCTTCCTGCAACTCGATGACCTGATGGGATTTCCCGAGGTGTTC
TTGAACCTCGATGCCATCTTGGTGCTGTTCCTCGCATGGCTAGTCGTGGTGCTGTGCTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAGTTCAAGTTGACGACGCTGGCTGGCTTCGTGCTGGTGCCGTT
CGCGCTGTGGAACAAGACCTCGTTCCTGGCCGAAAAGGTGCTGGGCAACGTGGTATCCGCTGGCGTCAAG
GTGCTGGTTCTGGCTGTGATCGTCGGTATCGGCTCGGGCCTTTTCGCGCAGTTCCAAGTCCATCCTGACG
AGCCTTCTATCGACCACGCGCTGGTCATCATGCTGGCCTCGCTCACCTTGCTGGCGCTCGGGATCTTCGG
CCCCGGCATCGCCACGGGCCTCGTGTCCGGTGCGCCCCAGCTCGGCGCGGGCGCGATGGCCGGTGCCGCT
ATCGGCGCAGCCGGAACGGCAGTGGCTGTCGGTGCTGCCGCGACGGGCGTGGGCGGTGCGGTGGCCGCTG
GTGCCCGCATGGCCCCGGCCGCCGCCAAGCTGGCCGGCAGCGGCGCGCGTGCCGCCACGTCGGCGGCTGG
CAGCGCGAAGTCGGCGTTCCAGGCCGGTTCCGCAGCAGCAGGCGGCGGTGCCAAAGGCGCGATGGCGGGC
TTGGGCAACGTCGCCAAGACCGGCGCGCAGTCCGCCGGACGCGCTGCCGCATCCCGCGCTTCCGCTGCTG
GGCAGCGCATGGCCGCGCCGTTCCGCGCTGGCTGGAAAGGCGACGCTGGCGCGTCAGCCGGCCAAGCCGC
CACCAGCGAAGCCCCCGCAGGCGCTGCCGCTGCACAGACGCCCGAGCAACCCGCCTGGGCCAAGCGGCTG
CAACGCCGCCAGCAACTCACTCATGCCGCGACCACCACCGCCCACACGCTGCGCGGTGGCGATGGCGGCG
GCTCCGGCCAAGGGCCGAGCCTGCGCGATTCCGACTCATAA
 Primer design