SecReT4
Protein ID: 116050555
T4SS name [ID]Trb [240]
Gene symbol-
Locus tagPA14_30860
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]2679709..2680698 [-]
ProductTrbG-like protein
Component typeTrbG
UniProt IDQ02N60
KEGG IDpau:PA14_30860
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.6e-68, Aligned region: 103..322
Protein Sequence: 329 a.a.     [Download]
>gi|116050555|ref|YP_790626.1| trbG gene product [Pseudomonas aeruginosa UCBPP-PA14]
MNDVFRKSALPLILLALAGCATQGKPPPTISLDEPVQAQPLPEPPAPVEVVKVPEPLALPAQLKPLPEAE
AAKPVPEPADETVRVSRANAEARIAPTREGYVNAIQVWPYTDGALYQVYAAVGRVTVITLQPGEELVTVA
AGDTVRWIVGDTSSGSGDALRVNVMVKPIRSGLKTNLVITTSRRTYLLELTSTEKTWMASVSWEYPKDKM
LALQRQAQAASAAAPVDTGLSLEKIRFRYAISGSNPPWKPLRAFDDGEKVYIQFPPGIAQGELPPLFVIG
AQGDGQLVNYRFRAPYYIVDRLFGAAELRLGGDKGDVVRIERTDGARRN
 
Nucleotide Sequence: 990 bp     [Download]
>gi|116048575|ref|NC_008463.1|:c2680698-2679709 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAATGATGTTTTCCGCAAATCCGCCTTGCCGCTGATCCTGCTGGCCCTCGCGGGCTGCGCCACGCAGG
GCAAGCCGCCGCCGACCATCTCGCTCGATGAGCCGGTGCAGGCGCAGCCGCTGCCGGAGCCGCCCGCGCC
GGTGGAGGTGGTCAAGGTGCCCGAGCCGCTGGCGCTGCCGGCGCAGTTGAAGCCATTGCCCGAAGCCGAG
GCTGCCAAGCCCGTCCCTGAACCTGCCGACGAAACCGTGCGCGTCTCGCGTGCCAACGCCGAGGCCCGCA
TCGCGCCCACGCGCGAGGGCTACGTCAATGCGATTCAGGTGTGGCCCTACACCGATGGCGCGCTGTATCA
GGTCTATGCGGCCGTGGGCCGCGTGACCGTGATCACGCTCCAGCCGGGCGAGGAACTGGTGACGGTCGCC
GCTGGCGACACTGTGCGCTGGATCGTGGGCGACACATCCAGCGGCAGCGGTGATGCGCTGCGCGTGAACG
TGATGGTGAAGCCCATCCGCTCGGGCCTCAAGACGAATCTGGTCATCACCACCAGCCGGCGCACCTACCT
GCTGGAGCTGACCTCGACAGAGAAGACGTGGATGGCGTCAGTGTCGTGGGAGTACCCGAAGGACAAGATG
CTGGCCTTGCAGCGCCAGGCGCAGGCGGCCAGCGCCGCCGCGCCAGTCGATACCGGCTTGTCGCTGGAGA
AGATCCGCTTCCGCTACGCGATCAGCGGCAGCAATCCGCCGTGGAAGCCGCTGCGCGCCTTCGATGACGG
CGAGAAGGTCTATATCCAGTTCCCGCCGGGCATCGCGCAAGGCGAGCTGCCGCCGCTGTTCGTCATCGGC
GCGCAGGGCGACGGGCAACTGGTGAACTACCGCTTCCGTGCGCCGTACTACATCGTGGATCGCCTCTTTG
GGGCGGCGGAGCTGCGCTTGGGCGGCGACAAGGGCGACGTGGTGCGGATCGAGCGCACGGACGGCGCGCG
GAGGAACTGA
 Primer design