SecReT4
Protein ID: 116052640
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59650
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5308021..5308776 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDQ02GI1
KEGG IDpau:PA14_59650
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 251 a.a.     [Download]
>gi|116052640|ref|YP_792955.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MIRTVSLLSGLMLLLSYPAAGQEAAASREASSQLSGSQLGTLKQQTSQSDLAQEWGLNQQEWTRYQTLMQ
GPRGAYSPGIDPLTALGIEARSAEERRRYADLQVQAERRRVEKELAYQRAYDEAFARAYPGEGVIRLTES
STANPSGTPNMSPALQSSGRLALFVQDNCTACIQRVRDLQHAEKEFDLYFVGSQNDAERVRRWAILAGID
PKKVRSKQITLNHDEGRWMALGLGGALPALVQEVNGRWQRL
 
Nucleotide Sequence: 756 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5308021-5308776 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGATCAGAACCGTATCGCTCCTGTCCGGCCTGATGCTGCTGCTGAGCTATCCCGCAGCCGGCCAGGAGG
CGGCGGCAAGCCGAGAGGCCAGCAGCCAACTGTCCGGTAGCCAACTCGGCACGCTGAAACAACAGACATC
TCAGAGCGACCTGGCCCAGGAGTGGGGACTGAACCAACAGGAATGGACCCGCTACCAGACGCTCATGCAA
GGCCCCCGGGGCGCTTACTCGCCTGGTATTGATCCGCTGACCGCGCTGGGCATCGAGGCGCGATCGGCAG
AGGAACGGCGGCGGTATGCCGATCTACAGGTCCAGGCCGAACGGCGCCGGGTCGAGAAGGAACTCGCCTA
CCAGCGCGCATACGACGAAGCCTTCGCCCGCGCCTATCCAGGCGAGGGGGTGATCCGCCTCACCGAAAGC
AGCACAGCCAACCCGTCGGGCACGCCGAACATGAGCCCAGCGTTGCAGAGCAGCGGGCGCCTGGCCCTGT
TCGTCCAGGACAACTGCACCGCCTGCATCCAGCGGGTCCGCGACCTGCAACATGCAGAAAAGGAGTTCGA
CCTCTACTTCGTCGGTAGCCAGAACGACGCAGAGCGAGTGCGGCGCTGGGCAATCCTCGCCGGCATCGAC
CCGAAGAAGGTTCGCAGCAAGCAGATCACGCTCAATCATGACGAGGGCCGCTGGATGGCCCTAGGACTGG
GCGGAGCCCTTCCCGCCCTGGTACAGGAGGTGAACGGCCGATGGCAACGTCTGTAG
 Primer design