SecReT4
Protein ID: 116052641
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59660
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5308761..5309342 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ02GI0
KEGG IDpau:PA14_59660
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 193 a.a.     [Download]
>gi|116052641|ref|YP_792956.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MATSVVRALQLATLLVLVNIAQAAVDPPPAYKQIALPKGVPAEVLYSVALTESKVLLRGEYVPWPWTLNV
AGKSYYYATRTAACTALLAAINLYGAKSVDSGLGQVNIGWNGHRFSSPCESLDPYKNLDATSDILIEQRD
ALYASAPGRPVDWIQVAGRYHRPAGGAPAAKYRRTVSRHLSQVLGVNLLVTNP
 
Nucleotide Sequence: 582 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5308761-5309342 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCAACGTCTGTAGTTCGAGCCCTCCAGTTGGCCACCCTGCTGGTCCTGGTCAACATCGCTCAGGCCG
CCGTGGATCCACCGCCGGCGTACAAGCAAATCGCCCTGCCCAAAGGGGTTCCGGCCGAGGTGCTCTACTC
GGTCGCGCTGACCGAGAGCAAGGTCCTGCTGCGCGGCGAATACGTTCCCTGGCCCTGGACATTGAACGTC
GCCGGGAAATCTTACTACTACGCGACCCGCACCGCCGCCTGCACAGCGCTACTCGCGGCGATCAACCTCT
ACGGGGCCAAGAGCGTCGATTCCGGCCTCGGCCAGGTCAACATCGGCTGGAACGGACATCGTTTCTCCAG
CCCCTGCGAGTCCCTGGATCCGTACAAGAACCTGGACGCCACCTCCGACATCCTGATCGAGCAGCGGGAC
GCCCTGTATGCATCCGCCCCGGGAAGACCGGTGGACTGGATCCAAGTTGCCGGCCGCTACCACCGCCCCG
CCGGCGGCGCGCCTGCCGCCAAATACCGTAGGACGGTTTCCCGCCACCTTAGCCAAGTTCTCGGCGTCAA
CCTACTGGTGACCAATCCATGA
 Primer design