SecReT4
Protein ID: 116052642
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59670
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5309339..5309839 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDQ02GH9
KEGG IDpau:PA14_59670
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 8.2e-47, Aligned region: 26..164
Protein Sequence: 166 a.a.     [Download]
>gi|116052642|ref|YP_792957.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MKKFLATLAFCTAFATQAWAAGLIVVEDLGGASALPYYQGLDPQPSASAPGPGDLGVRGSGAFPVRSARL
SPGRVQGRAINAPGLQLLFLVGDDTLSRTWLKERGDELRDLQAVGLAVNVASEARLTEIRAWGKGLQILP
APADDLVDRLGLQHYPALITSTAIQQ
 
Nucleotide Sequence: 501 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5309339-5309839 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAAGAAGTTCCTTGCCACGCTGGCATTTTGCACGGCGTTCGCGACTCAAGCCTGGGCCGCCGGGCTGA
TCGTTGTCGAAGACCTCGGCGGCGCCTCGGCGCTCCCCTACTACCAGGGCCTGGATCCGCAGCCATCCGC
TTCCGCACCAGGACCTGGCGACCTGGGCGTCCGTGGCTCAGGTGCGTTTCCAGTTCGCTCCGCCCGCCTA
TCGCCAGGACGGGTCCAGGGGCGCGCCATCAACGCTCCAGGCCTGCAACTGCTGTTCCTGGTCGGCGACG
ACACGCTGTCTCGAACCTGGCTGAAAGAGCGAGGCGACGAGCTTCGAGACCTCCAAGCCGTGGGCCTGGC
AGTGAACGTGGCCAGCGAAGCGCGCCTGACGGAAATCCGGGCCTGGGGGAAAGGACTTCAGATATTGCCG
GCGCCGGCGGACGACCTGGTCGACCGGCTAGGGCTGCAGCATTACCCCGCCCTCATCACATCCACCGCCA
TCCAGCAGTAG
 Primer design