SecReT4
Protein ID: 116052644
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59690
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5310109..5312343 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDQ02GH7
KEGG IDpau:PA14_59690
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.4e-14, Aligned region: 534..664
AAA_10 [PF12846], Evalue: 8.1e-08, Aligned region: 190..611
TrwB_AAD_bind [PF10412], Evalue: 6.1e-07, Aligned region: 532..674
Protein Sequence: 744 a.a.     [Download]
>gi|116052644|ref|YP_792959.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MAGQYPLEALLRPAVELYTTTVCFTAAALCIVAPWTFSLTPLFGIVAALCFAWLGIVRLKQAGVVLRYRR
NIRRLPKYTMTSAEMPVSNEHLFIGKGFRWTQKHTQRLADTYLPQFASYVEPSPLYERARRLEKQLEFAP
FPLKLVAKATAWDVAWNPARPLPPVGGLPRLHGIEPREQDVGLQLGERVGHTLVLGTTRVGKTRLAELFI
TQDIRRTHCRVRRRRVKMGRRTQTVHHGYRRRRAEEQPDYEVVIVFDPKGDADLLKRMYVECERAGRLDE
FYVFHLGHPDLSARYNAVGRFGRISEVATRVAGQLSGEGNSAAFREFAWRFVNIIARALHALGIRPDYQQ
ILRHVVNIDALFVEYAQKYISEHDPRAWDTIIQIEGKLNDKNIPFNMKGRPLRVVAIDQYLTQKRIADPV
MEGLKSAVRYDKTYFDKIVASLLPLLEKLTTGRISELLSPNYADLNDPRPIFDWMQVIRKRAVVYVGLDA
LSDTEVAAAVGNSMFSDLVSVAGHIYKHGVDDGLPGSLASGKVRINLHADEFNELIGDEFIPMVNKAGGA
GVQVTAYTQTMSDIEAKIGSRAKAGQIIGNFNNLFMLRVRETATAELLTNQLPKVQIYTSTPASGANDAI
NNNKKVAFTSSSHDQVQMTSVPMLEPAHIIGLPKGQAFALLEGGNLWKIRMPLPAVAPDEVMPKSLQELA
AGMRKGQAANSEWWEAPGYSALQDGLPQDLVDDFRHLGTGEDAA
 
Nucleotide Sequence: 2235 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5310109-5312343 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCTGGCCAGTACCCGTTGGAAGCGCTCTTGCGGCCTGCCGTGGAGCTCTACACCACCACCGTGTGCT
TCACCGCAGCCGCGCTCTGCATCGTCGCGCCGTGGACGTTCTCCCTCACTCCGCTGTTCGGCATCGTGGC
CGCGCTGTGCTTCGCCTGGCTGGGTATCGTGCGGCTGAAGCAGGCCGGCGTGGTGCTCCGCTACCGGCGG
AACATTCGCCGACTGCCGAAGTACACGATGACCAGCGCCGAGATGCCGGTCAGCAACGAACACCTGTTCA
TCGGTAAAGGATTTCGCTGGACGCAGAAGCATACGCAGCGCCTGGCAGATACCTACCTGCCCCAGTTCGC
CTCTTACGTCGAGCCCTCGCCCCTCTACGAGCGCGCGCGCCGGTTGGAGAAGCAGCTCGAGTTCGCCCCC
TTCCCCCTGAAGCTGGTCGCCAAAGCCACTGCCTGGGACGTGGCCTGGAACCCCGCACGGCCGCTGCCGC
CCGTGGGCGGTTTGCCTCGGCTCCATGGCATCGAGCCGCGCGAACAGGACGTAGGCCTGCAACTGGGCGA
GCGCGTCGGCCACACACTGGTACTCGGCACCACGCGGGTGGGTAAGACGCGCCTCGCGGAGCTGTTCATC
ACCCAGGATATTCGCCGCACTCACTGCCGGGTACGACGCCGGCGGGTGAAGATGGGCCGGCGGACCCAGA
CGGTTCACCACGGCTATCGGCGCCGGCGCGCAGAGGAGCAGCCGGACTACGAGGTGGTGATCGTCTTCGA
CCCGAAAGGCGACGCTGACCTGCTGAAGCGTATGTACGTGGAATGCGAACGTGCCGGCCGCCTGGACGAG
TTCTACGTGTTCCACCTCGGTCATCCTGACCTGTCGGCACGCTACAACGCCGTCGGCCGGTTCGGTCGGA
TCTCCGAGGTCGCCACCCGCGTCGCCGGCCAGCTCTCCGGCGAGGGCAACAGCGCGGCGTTCCGCGAGTT
CGCCTGGCGGTTCGTCAACATCATCGCCCGCGCGCTGCACGCGCTGGGTATCCGGCCTGACTACCAGCAG
ATCCTCCGGCACGTCGTGAACATCGATGCGTTGTTCGTCGAATATGCGCAGAAATACATCAGCGAGCACG
ATCCCAGGGCCTGGGACACCATCATCCAGATCGAGGGCAAGCTCAACGACAAGAACATCCCGTTCAACAT
GAAAGGACGGCCCCTGCGGGTCGTAGCCATCGACCAGTACCTGACACAGAAACGCATCGCCGACCCGGTC
ATGGAAGGCTTGAAGAGCGCCGTGCGCTACGACAAGACCTACTTCGACAAGATCGTGGCCTCGCTGCTGC
CGCTACTGGAGAAACTCACTACCGGGCGGATCTCGGAGCTTCTTTCGCCCAACTACGCGGACCTCAACGA
TCCGCGGCCGATCTTCGACTGGATGCAGGTCATCCGCAAACGCGCCGTGGTCTACGTCGGCCTCGACGCA
CTATCGGATACCGAGGTCGCCGCCGCGGTGGGCAACTCCATGTTCAGCGACCTGGTCTCGGTAGCGGGTC
ACATCTACAAGCATGGTGTCGATGACGGCCTGCCCGGCTCGCTCGCCAGCGGCAAGGTCCGCATCAACCT
GCATGCCGACGAGTTCAACGAGCTGATTGGCGACGAGTTCATCCCCATGGTCAACAAAGCGGGCGGCGCC
GGCGTGCAGGTGACGGCCTACACCCAGACCATGAGCGACATCGAGGCCAAGATCGGCTCCCGCGCGAAGG
CCGGTCAGATCATCGGCAACTTCAACAACCTGTTCATGCTGCGGGTGCGCGAGACCGCCACGGCCGAACT
CCTTACCAATCAGCTCCCCAAGGTCCAGATCTACACCAGCACGCCGGCGAGCGGCGCCAACGACGCGATC
AACAACAACAAGAAGGTAGCCTTCACCTCCAGCTCGCACGACCAGGTGCAGATGACCAGCGTGCCGATGC
TCGAGCCGGCCCACATCATTGGTCTGCCCAAAGGACAAGCGTTCGCGCTACTCGAGGGCGGCAATCTCTG
GAAGATCCGAATGCCGCTGCCGGCGGTCGCCCCCGACGAGGTGATGCCGAAAAGCCTGCAGGAGCTGGCT
GCCGGTATGCGCAAGGGCCAGGCCGCCAACAGCGAGTGGTGGGAGGCGCCGGGATACTCCGCCCTGCAGG
ATGGTCTGCCCCAGGACCTGGTCGACGATTTCCGTCACCTCGGCACCGGTGAGGATGCCGCCTGA
 Primer design