SecReT4
Protein ID: 116052645
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59700
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5312343..5313089 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ02GH6
KEGG IDpau:PA14_59700
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 8.1e-69, Aligned region: 46..245
Protein Sequence: 248 a.a.     [Download]
>gi|116052645|ref|YP_792960.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MAEVTQRAEQQQESQKTLLGTIISTPFQFLGVMFGSLIGAIIVEWVCLYFFWPDAGWKHAQAMFEYELSW
LSQGLLHSVVVQEPGRTATWLAQLAYDWLFVKTGMVDWMTNMTTIAQAGPRSPLDVRYLTAQGVSTLQNY
GLAALYTVLTFVVRLVILVMTIPLFVMAAFTGLVDGLVRRDLRKFGAGRESSYLYHKARGSIIPLAVVPW
TLYLAIPININPLLILLPCAALLGVAVCITASTFKKYL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5312343-5313089 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGCTGAAGTCACTCAACGAGCAGAGCAGCAACAAGAGAGCCAGAAGACCCTTCTCGGCACCATCATCA
GTACGCCCTTCCAATTTCTCGGCGTGATGTTCGGGTCGCTGATCGGCGCAATCATCGTGGAGTGGGTTTG
CCTGTATTTCTTCTGGCCTGACGCGGGCTGGAAGCATGCCCAGGCCATGTTTGAGTACGAACTCAGTTGG
CTGTCGCAGGGGCTGCTACACAGCGTCGTCGTGCAGGAGCCAGGTCGAACCGCCACCTGGCTGGCCCAGT
TGGCCTATGACTGGTTGTTCGTGAAGACCGGGATGGTCGACTGGATGACCAACATGACTACCATCGCGCA
GGCCGGGCCACGGAGCCCGCTGGACGTTCGCTATCTCACCGCCCAGGGTGTCTCCACGCTGCAGAACTAC
GGCCTGGCCGCGCTGTACACGGTGCTGACATTCGTCGTGCGCCTGGTGATCCTGGTCATGACGATCCCGT
TATTCGTGATGGCCGCGTTCACCGGCCTGGTGGACGGCCTGGTGCGCCGGGACCTGCGCAAGTTCGGCGC
CGGCCGGGAGTCCAGCTACCTCTACCACAAGGCGCGCGGCAGCATCATTCCGCTAGCGGTCGTCCCTTGG
ACGCTCTACCTGGCAATTCCCATCAACATCAATCCCCTGCTCATCCTGTTGCCCTGCGCCGCACTGCTCG
GCGTAGCGGTGTGCATCACAGCATCCACCTTCAAAAAGTACCTATAG
 Primer design