SecReT4
Protein ID: 116052654
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59820
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5327953..5328603 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ02GG7
KEGG IDpau:PA14_59820
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.1e-69, Aligned region: 14..213
Protein Sequence: 216 a.a.     [Download]
>gi|116052654|ref|YP_792969.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MFGSLIGAIIVEWVCLYFFWPDAGWKHAQAMFEYELSWLSQGLLHSVVVQEPGRTATWLAQLAYDWLFVK
TGMVDWMTNMTTIAQAGPRSPLDVRYLTAQGVSTLQNYGLAALYTVLTFVVRLVILVMTIPLFVMAAFTG
LVDGLVRRDLRKFGAGRESSYLYHKARGSIIPLAVVPWTLYLAIPISINPLLILLPCAALLGVAVCITAS
TFKKYL
 
Nucleotide Sequence: 651 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5327953-5328603 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGTTCGGGTCGCTGATCGGCGCAATCATCGTGGAGTGGGTATGCCTGTATTTCTTCTGGCCTGACGCGG
GCTGGAAGCATGCCCAGGCCATGTTTGAGTACGAACTCAGTTGGCTGTCGCAGGGGCTGCTACACAGCGT
CGTCGTGCAGGAGCCAGGTCGAACCGCCACCTGGCTGGCCCAGTTGGCCTATGACTGGTTGTTCGTGAAG
ACCGGGATGGTCGACTGGATGACCAACATGACTACCATCGCGCAGGCCGGGCCACGGAGCCCGCTGGACG
TTCGCTATCTCACCGCCCAGGGTGTCTCCACGCTGCAGAACTACGGCCTGGCCGCGCTGTACACGGTGCT
GACATTCGTCGTGCGCCTGGTGATCCTGGTCATGACGATCCCGTTATTCGTGATGGCCGCGTTCACCGGC
CTGGTGGACGGCCTGGTGCGCCGGGACCTGCGCAAGTTCGGCGCCGGCCGGGAGTCCAGCTACCTCTACC
ACAAGGCGCGCGGCAGCATCATTCCGCTAGCGGTCGTCCCTTGGACGCTCTACCTGGCAATCCCCATCAG
CATCAATCCCCTGCTCATCCTGTTGCCCTGCGCCGCGCTGCTCGGCGTAGCGGTATGCATCACAGCATCC
ACCTTCAAAAAGTACCTGTAG
 Primer design