SecReT4
Protein ID: 116052658
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59860
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5332241..5332600 [+]
Producttype III effector Hop protein
Component typeTfc9
UniProt IDQ02GG2
KEGG IDpau:PA14_59860
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.1e-31, Aligned region: 33..111
Protein Sequence: 119 a.a.     [Download]
>gi|116052658|ref|YP_792974.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MICTRFAVNTPHPSLRRSCLAVLACSALVAQGAFAASASEQANLEVMIRQLNALEDTARRSAQGADEPGQ
RFYFDYPRLAADLQRIRQGLQDYMTPSRAQPRDPSDLSGNYTLRGGPMP
 
Nucleotide Sequence: 360 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5332241-5332600 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
CTGATCTGCACGAGATTCGCCGTGAACACTCCACATCCATCCCTTCGCCGAAGCTGCCTGGCCGTCTTGG
CCTGCAGTGCGCTGGTCGCACAGGGAGCTTTCGCAGCGAGCGCCTCCGAGCAGGCGAACCTGGAGGTGAT
GATCCGGCAGCTCAACGCCCTCGAGGACACCGCCCGCCGCAGTGCCCAGGGCGCCGATGAGCCCGGACAG
CGCTTCTACTTCGACTACCCGCGCCTGGCCGCTGACCTGCAGCGCATCCGCCAAGGCCTGCAGGACTACA
TGACGCCCAGCCGCGCCCAACCGCGTGACCCTTCCGACTTATCAGGGAATTACACCCTGCGCGGAGGGCC
GATGCCATGA
 Primer design