SecReT4
Protein ID: 116052661
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59890
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5333221..5333607 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ02GF9
KEGG IDpau:PA14_59890
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.5e-44, Aligned region: 9..125
Protein Sequence: 128 a.a.     [Download]
>gi|116052661|ref|YP_792977.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MPEEHLFQDGTLSFLPTRLNRQPVVIGGLTADEMWITVFTSGAAGFVLGIPAALVAGNAACIPLGALLVG
ALGLGIGSRVLRRMKRGRPDTWFYRQVEMALSLRFPVFGNRRLVTRSGAWTSRRTESP
 
Nucleotide Sequence: 387 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5333221-5333607 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCCCGAAGAACATCTGTTTCAGGATGGAACCCTCAGCTTCCTGCCGACCCGTTTGAACCGGCAACCGG
TAGTCATCGGCGGCCTGACCGCAGACGAAATGTGGATCACGGTCTTCACCAGCGGAGCAGCCGGGTTCGT
TCTTGGCATCCCGGCTGCCTTGGTCGCAGGTAACGCTGCCTGCATTCCACTGGGCGCGCTGCTGGTCGGC
GCCCTCGGCCTAGGTATCGGCAGCCGCGTCCTGCGGCGGATGAAGCGGGGGCGGCCCGATACCTGGTTCT
ACCGCCAGGTGGAGATGGCCCTCTCGCTGCGCTTTCCCGTCTTCGGCAACCGTCGCCTGGTTACGCGCTC
CGGCGCCTGGACCAGTCGACGCACGGAGTCCCCATGA
 Primer design