SecReT4
Protein ID: 116052662
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59900
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5333604..5334263 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDQ02GF8
KEGG IDpau:PA14_59900
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.9e-86, Aligned region: 4..204
Protein Sequence: 219 a.a.     [Download]
>gi|116052662|ref|YP_792978.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MSFRKHTAQQQAHINTFRFITGFLCMVIVVLAYCVWEARKDLWIHIPPDLRSGSTRLWWDIPPESVYAFG
LYIFQQVQRWPKDGEVDYKGNLFRYAAYLTPSCKVFLEKDFEFRRNAGELRGRERTTSEIPGRGIGESNG
RVIQHSINDWTVNLDMDSTEYYAGEKIKRALARYPLHVIRADVDPETNPFGLQWDCYSDTPQRIELEEPA
APTKREGGL
 
Nucleotide Sequence: 660 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5333604-5334263 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGAGTTTCAGAAAACACACTGCGCAACAGCAGGCACACATCAACACCTTCCGGTTCATCACCGGCTTCC
TGTGCATGGTCATCGTTGTGCTGGCCTACTGCGTCTGGGAAGCCCGTAAGGACCTCTGGATCCACATTCC
GCCCGACTTGCGCTCAGGAAGCACCCGGTTGTGGTGGGACATTCCGCCAGAGAGCGTCTATGCGTTCGGC
CTCTACATCTTCCAGCAGGTGCAGCGTTGGCCCAAGGACGGCGAGGTGGACTACAAGGGAAACCTGTTCC
GCTACGCTGCCTACCTCACTCCCTCCTGCAAAGTCTTCCTGGAGAAAGACTTTGAGTTTCGTCGTAACGC
CGGCGAGCTCAGGGGTCGCGAGCGCACCACCTCGGAAATCCCCGGTCGAGGCATTGGCGAGAGCAATGGC
CGCGTGATCCAGCACTCGATCAATGACTGGACCGTCAACTTGGACATGGACAGCACGGAGTATTACGCCG
GCGAGAAGATCAAGCGGGCGCTGGCCCGCTACCCGTTGCACGTTATCCGCGCCGACGTCGACCCGGAAAC
CAATCCCTTCGGCCTGCAGTGGGACTGCTACTCCGACACGCCTCAACGTATCGAGCTTGAGGAGCCGGCC
GCCCCCACCAAGCGGGAGGGAGGTCTATGA
 Primer design