SecReT4
Protein ID: 116052663
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59910
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5334260..5335144 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDQ02GF7
KEGG IDpau:PA14_59910
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 2.4e-125, Aligned region: 5..287
Protein Sequence: 294 a.a.     [Download]
>gi|116052663|ref|YP_792979.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MIRKSTGSLLLMLALPTLAHAVEILRWERIPLAIPLTVGQERIVFVDRNVRVGVPRDLQGKLRVQSTGGA
LYLLANEPIPPARLRLQDATNGEQMLIDIAATEATADQQPREPVRIVAGEPVDPHYGQSREAQPSAAAKQ
TEHAEAPKAVPRETPVPVVLTRYAAQMLYAPLRTVEPVDGVGQVRVKRQLDLTTLLPSLPITATALGAWR
LDDYYITAVKLQNASAQHLALDPRDLMGNFVAATFQHPYLGPRGDASDTTTVYLVTRGRGLADALLPSSI
SQIDPKGGRRGADR
 
Nucleotide Sequence: 885 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5334260-5335144 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGATCCGGAAGTCGACAGGCTCGCTCTTGCTAATGCTTGCCCTACCCACACTGGCCCACGCGGTGGAGA
TTCTGCGCTGGGAGCGCATTCCGTTGGCCATTCCATTGACGGTCGGCCAGGAACGCATTGTCTTCGTCGA
CAGAAACGTGCGAGTTGGGGTTCCTCGGGATCTGCAGGGCAAGCTGCGCGTCCAGAGTACCGGCGGCGCA
CTCTACCTGCTCGCCAACGAGCCGATTCCTCCAGCGCGCCTGCGCCTACAGGACGCGACCAATGGCGAGC
AGATGCTCATCGATATCGCCGCCACCGAAGCAACGGCCGACCAACAGCCGCGCGAGCCGGTCAGGATCGT
CGCCGGCGAGCCAGTGGATCCGCATTATGGCCAGTCCCGGGAAGCCCAGCCATCGGCAGCAGCGAAACAG
ACCGAGCACGCAGAAGCACCGAAGGCCGTGCCGCGCGAAACGCCCGTCCCCGTGGTTCTGACGCGCTATG
CGGCGCAGATGCTCTATGCCCCGCTTCGCACGGTGGAACCGGTGGATGGCGTCGGTCAGGTGCGCGTCAA
GCGACAGCTCGACCTGACCACCCTGCTCCCCAGCCTACCCATCACGGCTACCGCCTTGGGCGCCTGGCGG
CTGGACGACTACTACATCACGGCGGTGAAGCTGCAGAACGCCAGCGCCCAGCACCTGGCCCTGGATCCCA
GGGACCTGATGGGCAATTTCGTCGCCGCGACCTTCCAGCACCCGTACTTGGGGCCCCGGGGCGACGCCTC
CGACACCACTACCGTGTATCTGGTGACGCGCGGCCGCGGCCTTGCCGACGCGCTCCTGCCCTCCTCCATC
AGCCAGATCGATCCCAAAGGAGGCCGTCGTGGCGCTGACCGGTAA
 Primer design