SecReT4
Protein ID: 116052664
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59920
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5335128..5336633 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDQ02GF6
KEGG IDpau:PA14_59920
PDB IDNA
Domain hit(s) vs Pfam DUF972 [PF06156], Evalue: 6.7e-05, Aligned region: 62..122
Protein Sequence: 501 a.a.     [Download]
>gi|116052664|ref|YP_792980.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MALTGNPLLKLLVVPVVIGAILIGVSMMGKKESAQSQGAATPTVTSEEAATLGIDGDTPADTLRTIVAES
RQLKDQISKVIQENDSLKAANENLQGRLRNIDQNIEQKLNNTAQELQQQQENRSQTILDQVQKRLENLTH
IPEAGDTDLPVGFGVRPKDGQHFQGAGSSSSDIVWIEPQDARAVDANGQPLAAGSTTQPSGFSFPTSFGN
AVDRGQNALERIDDGLHPVGQQRSDLENRKLVRKTYTLPQNSTLMGSVAMSALIGRVPVDGTVNDPYPFK
ILIGPDNLTANGIELPDVAGAVASGTASGDWTLSCVRGQIRSLTFVFNDGTVRTFPAPAEEVNDNQSNNN
QTASADQKTIQGGLGWISDPYGIPCIAGDRRSNAKEYLGNQSLLTAAGAGIAKLLDADENNTSTVFSGNG
TSFGTTGTNSNSALNSILSGGVSDIRQWMNKLYGEAFAAVYVQPGARVAVHLDQQLAIDYELKGRKVDYS
SGAAHATADLD
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5335128-5336633 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
GTGGCGCTGACCGGTAATCCCCTCCTGAAATTGCTGGTCGTCCCCGTCGTGATCGGCGCCATCCTGATCG
GCGTGAGCATGATGGGCAAGAAAGAAAGTGCGCAGTCACAAGGCGCCGCAACCCCGACGGTAACGTCGGA
AGAAGCGGCAACCCTGGGCATCGACGGCGACACGCCCGCCGACACACTACGCACCATCGTGGCGGAAAGC
CGGCAGCTCAAGGACCAGATCAGCAAGGTGATCCAGGAGAATGACTCGCTCAAAGCCGCCAATGAGAACC
TGCAGGGCCGCCTGCGCAACATCGATCAGAACATCGAGCAGAAGCTCAACAACACCGCCCAGGAACTGCA
GCAACAGCAGGAAAACCGTAGCCAGACGATCCTGGACCAGGTACAGAAACGGCTCGAGAACCTAACCCAC
ATTCCCGAGGCCGGTGACACCGACCTGCCCGTAGGATTCGGCGTGCGACCAAAGGATGGCCAGCACTTTC
AGGGAGCGGGCTCGTCTTCATCGGATATCGTCTGGATCGAGCCCCAGGACGCCCGCGCGGTTGATGCCAA
TGGCCAGCCGCTGGCCGCCGGCTCCACCACCCAACCGAGCGGATTCAGCTTCCCGACCTCCTTCGGCAAT
GCGGTCGATCGCGGACAGAACGCGCTGGAGCGGATCGATGACGGGCTGCACCCCGTCGGCCAACAGCGAT
CTGACCTGGAAAACCGCAAGCTCGTCCGTAAGACCTACACGCTGCCGCAGAACTCGACGCTCATGGGCTC
GGTGGCCATGTCTGCGCTGATCGGTCGTGTGCCGGTCGACGGGACGGTCAATGATCCTTACCCGTTCAAA
ATCCTCATCGGCCCGGACAACCTCACCGCCAACGGCATCGAGCTGCCGGACGTCGCCGGCGCGGTAGCCA
GCGGGACCGCCTCGGGCGACTGGACACTCTCCTGCGTGCGTGGGCAGATCCGCAGCCTCACGTTCGTGTT
CAACGACGGGACCGTGCGCACCTTCCCGGCGCCGGCCGAGGAGGTGAATGACAACCAGAGCAACAACAAC
CAGACCGCCAGCGCCGACCAGAAAACCATCCAGGGCGGCCTCGGCTGGATCAGCGACCCCTACGGCATCC
CATGCATCGCCGGTGATCGCCGATCCAATGCCAAGGAGTACCTGGGCAATCAGAGCCTACTCACGGCTGC
CGGGGCCGGCATTGCCAAGCTCCTGGACGCCGACGAGAACAACACCAGTACCGTCTTCAGCGGCAACGGC
ACCAGCTTCGGGACGACCGGAACCAACAGCAACTCGGCCCTCAACAGCATCCTCTCCGGCGGCGTCAGCG
ACATCCGGCAGTGGATGAACAAGTTGTACGGGGAGGCCTTCGCCGCCGTCTACGTGCAGCCAGGTGCGCG
GGTCGCAGTGCATCTCGATCAGCAACTGGCGATCGACTATGAACTCAAGGGCCGCAAGGTCGATTACAGC
TCTGGAGCCGCTCATGCAACAGCAGACTTGGACTAA
 Primer design