SecReT4
Protein ID: 116052665
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59930
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5336611..5337054 [+]
Producthypothetical protein
Component typeTfc15
UniProt IDQ02GF5
KEGG IDpau:PA14_59930
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 147 a.a.     [Download]
>gi|116052665|ref|YP_792981.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MQQQTWTNPLLRLCAGLACALTLAACSTSKEEMLPHGEANMLDVWERGATSSIGNSRGRLLLDARQTLRR
PIDPQQDASANDQADYTRTASNEIHSQFKRLPNPDLVMYVFPHLAGSDPAPVPGYTTVFPFYQRVQYAMP
GERTEDY
 
Nucleotide Sequence: 444 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5336611-5337054 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCAACAGCAGACTTGGACTAACCCCCTTCTTCGTCTCTGCGCCGGCCTGGCCTGCGCGCTGACCCTGG
CAGCGTGCTCCACCAGCAAGGAGGAGATGCTGCCCCACGGCGAGGCCAACATGCTCGACGTCTGGGAGCG
AGGTGCGACCAGCTCGATAGGCAACAGCCGTGGCCGGCTGCTCCTCGATGCCAGGCAAACGCTGCGGCGC
CCAATCGATCCGCAGCAGGATGCCTCCGCGAATGACCAGGCCGACTACACCCGCACGGCCAGCAACGAGA
TCCACAGTCAGTTCAAACGACTGCCCAATCCCGACCTGGTGATGTATGTGTTCCCGCACCTGGCCGGCAG
CGATCCCGCCCCGGTACCGGGCTACACCACCGTGTTCCCCTTCTACCAGCGAGTCCAGTACGCCATGCCG
GGCGAACGCACGGAGGACTATTGA
 Primer design