SecReT4
Protein ID: 116052666
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59940
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5337054..5339996 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDQ02GF4
KEGG IDpau:PA14_59940
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 4e-68, Aligned region: 72..348
AAA_10 [PF12846], Evalue: 1.7e-44, Aligned region: 543..883
FtsK_SpoIIIE [PF01580], Evalue: 2.8e-06, Aligned region: 539..573
Protein Sequence: 980 a.a.     [Download]
>gi|116052666|ref|YP_792982.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MGFFQTLLRGRTQPQSVPADAPEDSGALDVAAAEEATERYLARLAAMGIPLPNTGSKNGATQAEASRLYD
HDPSFVDLLPWAEYLPDEQVMLLEDGRSRAAFFELVPLGTEGRDPNWMQNARDALKEALQNSFDEHETSP
WIVQFYAQDEISWDNFQEQLRQYVHPRARGSAFSEMYLALMKHHLEGISKPGGLFVDTAVSKLPWRGQQR
RVRMVVYRRIRKEDAQIRGQDPAAYLKSICERIQGGLANAGIVASRMGGQEIRNWLIRWFNPHPDHLGQA
EADLRRFYELVCRPDEPILQDELPLADGTDFSQNLFYRQPVSDATQGVWLFDAMPHRVIVVDQLNKAPLT
GHFTGETLKGDGLNALFDRMPEDTLLCITMVVTPQDMLEGHLQQLSKKAVGDTQASIHTREDVATVRRLI
GREHKLYRGAIALFVRGRDHTQLEERCITLSNVLLGAGLVPVEPQNEVGPLNSYLRWLPSNFDPNEKRAL
EWYTQMMFAQHIANLSPIWGRTTGTGHPGFTLFNRGGAPLTFDPFNKLDRQMNAHGFIFGPTGSGKSASL
TNLICQMLAMYLPRMFVAEAGNSFGLLADLAKRFGLSVHRVRLAPGSGVSLAPFADAIKLVESPDQVKVL
DAEDIEASDSVQGSKADLEDDQRDILGEMEIVARLMITGGEEKEDARLTRADRSAVRQAILAAARTCAAA
NRTVLTQDVRDALYEASRSDSTAPERRARIAEMAEAMQMFCMGADGEMFNREGTPWPEADLTVVDFATYA
REGYAAQLGIAYISLLNTVNNIAERDQFKGRPIVKITDEGHIITKHPLLLPYAMKITKMWRKLGAWFWLA
TQNIDDIPASGAPMLNMIEWWLCLNMPPDEVEKISRFRELSPAQKSMMLSARKESGKFTEGVLLAKGKEY
LVRVVPPSLYLALAMTENEEKNQRYNIMQATGCDELEAALQVAADLDKARGLPPFPIVFPDQPAVECQDE
 
Nucleotide Sequence: 2943 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5337054-5339996 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGGGCTTTTTTCAAACCCTTCTGCGCGGTCGCACACAGCCTCAGTCGGTACCGGCAGACGCTCCCGAAG
ATTCAGGAGCGCTGGACGTAGCGGCCGCGGAAGAAGCGACTGAGCGCTATCTGGCGCGACTGGCCGCCAT
GGGTATTCCTCTGCCCAACACCGGGAGCAAGAATGGCGCCACGCAGGCCGAAGCGTCACGCCTCTACGAT
CACGACCCATCGTTCGTAGACCTGCTGCCCTGGGCTGAGTACCTGCCCGACGAGCAAGTGATGCTCCTGG
AGGATGGGCGTTCGCGCGCCGCATTCTTCGAACTGGTGCCCTTGGGCACCGAGGGCCGCGATCCCAATTG
GATGCAGAACGCCCGGGACGCATTGAAAGAAGCCCTGCAGAACTCCTTCGACGAGCACGAAACCTCACCC
TGGATTGTCCAGTTCTACGCCCAGGACGAGATCAGCTGGGACAATTTCCAGGAGCAGTTGAGGCAGTACG
TCCATCCTCGAGCGCGAGGATCGGCCTTCAGCGAGATGTACCTGGCGCTCATGAAGCATCACCTGGAGGG
CATTTCGAAGCCGGGCGGACTGTTCGTCGACACCGCCGTCAGCAAGCTGCCCTGGCGAGGACAACAGCGC
CGCGTGCGGATGGTCGTCTACCGCCGGATCCGCAAGGAGGATGCGCAGATTCGCGGACAGGACCCGGCGG
CGTACCTGAAATCCATCTGCGAGCGTATCCAAGGCGGCCTGGCGAACGCCGGCATCGTCGCTTCGCGCAT
GGGCGGACAGGAGATCAGGAACTGGTTGATCCGCTGGTTCAACCCGCACCCGGATCACCTCGGCCAGGCC
GAGGCGGACCTACGTCGCTTCTACGAACTGGTATGCCGTCCGGACGAACCGATCCTGCAGGATGAATTGC
CACTGGCCGACGGCACTGACTTCTCCCAGAACCTGTTCTATCGGCAGCCTGTTTCCGATGCCACCCAGGG
CGTATGGCTCTTCGATGCCATGCCGCACCGAGTGATTGTGGTCGACCAGTTGAACAAAGCGCCGCTGACA
GGCCACTTCACCGGCGAGACGCTCAAAGGCGATGGCCTCAACGCCCTGTTCGATCGAATGCCCGAGGACA
CGCTGCTGTGCATCACCATGGTCGTGACGCCGCAGGACATGCTGGAAGGGCATCTGCAGCAGCTCTCGAA
AAAGGCCGTTGGTGACACCCAGGCCTCGATCCACACCCGCGAGGACGTGGCCACCGTTCGACGCCTGATC
GGCCGGGAGCACAAGCTCTATCGCGGAGCGATCGCTCTGTTCGTGCGCGGCCGCGACCATACCCAGTTGG
AGGAACGCTGCATCACCCTGAGCAACGTACTGCTCGGCGCCGGCCTGGTGCCGGTCGAACCGCAGAACGA
AGTCGGACCGCTGAACAGCTACCTGCGCTGGCTCCCCTCAAACTTCGATCCAAACGAGAAGCGAGCCCTG
GAGTGGTACACCCAGATGATGTTCGCTCAGCACATCGCCAACCTGTCGCCCATCTGGGGGCGCACCACCG
GTACCGGACACCCTGGCTTCACGCTGTTCAACCGTGGCGGCGCGCCGTTGACCTTCGACCCGTTCAACAA
GCTGGACCGGCAGATGAATGCCCACGGCTTCATCTTCGGGCCAACTGGCTCCGGCAAGTCGGCGTCCCTG
ACCAACCTCATCTGCCAGATGCTCGCCATGTACCTGCCGCGGATGTTCGTCGCGGAAGCGGGCAACAGCT
TCGGCCTGCTGGCCGACTTAGCCAAGCGGTTTGGCCTCTCGGTCCACCGGGTGCGCCTCGCCCCGGGCTC
CGGCGTCAGCCTGGCGCCGTTCGCGGACGCCATCAAGCTGGTCGAGAGCCCCGACCAAGTGAAGGTGCTG
GACGCCGAAGACATCGAGGCCTCGGACTCGGTCCAGGGCAGCAAGGCCGACCTCGAGGACGACCAGCGAG
ACATCCTGGGCGAGATGGAGATCGTCGCCCGCCTCATGATTACCGGTGGCGAAGAGAAGGAAGATGCGCG
CCTGACCCGTGCCGATCGCAGCGCCGTCCGCCAGGCGATCCTGGCGGCGGCCAGGACCTGCGCCGCCGCG
AACCGCACGGTACTGACCCAAGACGTGCGCGATGCGCTCTACGAGGCCTCCAGGAGCGATAGCACCGCGC
CAGAACGCCGCGCGCGGATCGCCGAAATGGCGGAAGCCATGCAGATGTTCTGCATGGGCGCCGACGGCGA
GATGTTCAATCGCGAAGGCACGCCCTGGCCTGAGGCCGACCTTACCGTGGTGGATTTCGCAACGTACGCG
CGCGAAGGCTACGCCGCCCAGCTCGGGATCGCCTACATCTCGCTGCTGAACACCGTGAACAACATCGCCG
AACGCGACCAGTTCAAGGGCCGGCCAATCGTCAAGATCACCGATGAGGGGCACATCATCACCAAGCACCC
GCTGCTGCTGCCCTACGCCATGAAGATCACCAAGATGTGGCGGAAACTGGGCGCCTGGTTCTGGCTCGCC
ACCCAGAACATCGACGACATCCCAGCCTCCGGGGCGCCGATGCTGAACATGATCGAGTGGTGGTTGTGCC
TGAACATGCCCCCCGACGAAGTAGAGAAGATATCCAGGTTCCGCGAGCTGTCGCCGGCGCAGAAGTCGAT
GATGCTCTCGGCCCGCAAGGAAAGCGGCAAGTTCACCGAGGGCGTGCTCCTGGCCAAGGGCAAAGAATAC
CTCGTCCGTGTGGTTCCCCCGAGTCTCTACCTGGCCCTGGCCATGACCGAAAACGAAGAAAAGAACCAGC
GCTACAACATCATGCAAGCCACCGGCTGCGACGAGCTCGAGGCGGCCTTGCAGGTCGCAGCGGATCTCGA
CAAGGCGCGCGGCCTGCCACCCTTCCCCATTGTTTTCCCAGACCAACCGGCAGTGGAGTGCCAGGACGAA
TGA
 Primer design