SecReT4
Protein ID: 116052670
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59980
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5341357..5341788 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDQ02GF0
KEGG IDpau:PA14_59980
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.6e-40, Aligned region: 30..141
Thioredoxin_3 [PF13192], Evalue: 6.2e-05, Aligned region: 75..136
Protein Sequence: 143 a.a.     [Download]
>gi|116052670|ref|YP_792986.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MPLHHSPPGRRPPTLAVGVLLVLLSSASQAETWVITDKAHPVSATGSSRVLFLDAQEHLEEQLTAALPQD
PQHAQAAFKRLLQSPDGRRLQAELVKAQQDVADAWSLGVEKIPAVVVDRQYVVYGEPDVSRALELIAKAR
RSR
 
Nucleotide Sequence: 432 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5341357-5341788 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCCTCTTCATCACTCCCCCCCTGGCCGGCGGCCACCAACGCTGGCCGTTGGCGTACTACTGGTACTGC
TGAGCAGCGCGAGTCAGGCCGAAACCTGGGTCATCACCGACAAGGCTCATCCGGTCTCTGCCACCGGATC
GTCGCGCGTTCTGTTTCTGGACGCCCAGGAACACCTCGAGGAGCAACTGACTGCGGCCTTGCCCCAGGAT
CCACAGCATGCTCAAGCGGCGTTTAAGCGATTGCTACAAAGCCCCGATGGGCGCCGCCTGCAGGCAGAGC
TGGTCAAGGCACAACAAGACGTCGCCGATGCGTGGAGTCTCGGTGTCGAGAAGATCCCTGCCGTAGTAGT
CGATAGGCAGTACGTGGTCTACGGCGAACCGGATGTTTCGCGCGCTCTTGAGCTAATCGCCAAGGCCAGG
AGGTCGCGCTGA
 Primer design