SecReT4
Protein ID: 116052671
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_59990
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5341788..5342726 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDQ02GE9
KEGG IDpau:PA14_59990
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4e-91, Aligned region: 30..300
Protein Sequence: 312 a.a.     [Download]
>gi|116052671|ref|YP_792987.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MTSLNLRRLAAAAATFSLSFTASAAINSAAIVSSTLSPQCLEYKVVGICYWLLCGPHGCKVKTSVKVRHY
VPDAVVSSYANTGSNPWTEVSALGTPNPLAQAGNDATTNYKAENSIGRFKEADVIGHPGGATFSRFASAS
GYVCPGATVPLVPYFLSTLDAIGWRHGIPEQVYPEALVPGLREVGGIFSGDMWGNLYPRSGFLHQTDDYK
TAAVIAQRAGDITTRIGQLHVYLPMRAAPKDGYWPAGELKEGDASTGKWQELTPSLSLNCAVFPNSGPKT
QAVDGDYAWALWRPYSCCQRKGQIFLGSTDFQ
 
Nucleotide Sequence: 939 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5341788-5342726 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGACCAGCCTCAACCTCCGCCGCCTGGCAGCGGCGGCCGCCACCTTCAGCCTCTCGTTCACGGCCTCGG
CCGCGATCAACAGCGCTGCCATCGTCTCCTCCACCCTTTCCCCTCAGTGCCTCGAATACAAGGTCGTCGG
GATCTGTTACTGGCTGCTCTGCGGCCCGCATGGCTGCAAAGTGAAGACGTCGGTCAAGGTCCGCCACTAC
GTGCCTGACGCAGTCGTCTCCAGCTACGCGAATACCGGGAGCAACCCCTGGACCGAGGTATCGGCGCTGG
GTACACCGAATCCACTCGCCCAGGCCGGCAATGACGCGACCACAAACTACAAGGCCGAGAACAGCATCGG
CCGCTTCAAGGAAGCGGATGTGATCGGCCATCCTGGTGGCGCCACGTTCAGCCGGTTCGCCAGCGCCTCT
GGGTACGTTTGCCCTGGCGCCACCGTCCCGCTGGTGCCGTACTTTCTCAGCACACTGGACGCCATTGGCT
GGCGGCATGGAATTCCCGAGCAGGTGTACCCCGAAGCGTTGGTCCCAGGGCTGCGCGAGGTGGGTGGAAT
CTTCTCCGGCGACATGTGGGGGAACCTCTATCCGCGCAGCGGCTTCCTGCACCAGACCGACGACTACAAG
ACGGCAGCCGTCATCGCCCAGCGCGCCGGCGATATCACCACGCGAATCGGCCAGCTCCACGTCTACCTCC
CCATGCGCGCAGCCCCCAAGGACGGCTACTGGCCGGCGGGCGAGCTGAAAGAGGGCGATGCCTCGACCGG
GAAATGGCAGGAGCTGACCCCATCCCTGAGCCTCAACTGCGCGGTGTTTCCCAACTCTGGGCCGAAGACG
CAAGCCGTCGACGGCGATTACGCCTGGGCGCTCTGGCGTCCCTACTCCTGCTGCCAGCGCAAGGGGCAGA
TCTTCCTCGGCAGTACCGACTTCCAATAA
 Primer design