SecReT4
Protein ID: 116052672
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_60000
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5342744..5344126 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ02GE8
KEGG IDpau:PA14_60000
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 460 a.a.     [Download]
>gi|116052672|ref|YP_792988.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MRMNITSVALMWLLAAQLAQADDPINVSKTGTVLSDEVLYSIGGGSAVSMGSAGQMDSIGVGFGWNNDMM
CGNMNLSTTLENQLNGATQGFQNIMGSVIQNATGAVMSLPALIIQRANPQLYNLITNGILQARIDYDRSK
GTCRAIAEKMADIAGEQTGWGKIAEGQALGATLASDGKDAVSALEAVEKKGGNDGVTWVGGDKAGGSGQK
PIRIVNDVTRAGYNLLTSRSVNDSSSVPSATCNNGLVCNTWSSPQEAAAFATRVLGEQQQQTCEGCQKTV
TAAGVGLTPLIQETYDKKLQSLQELLSKSKPLTAENLAAAGTDALPITRGVIEALRDERDQDVLARRLAS
DVSLMDVLSKALLLQRLMFAGAKEPNVAANGLATQAVDQQTSLLQQEISNLKTELELRRELASNSPMRVI
ERGQQRASGSSGVFESAPDADRLDRLQAPSAAGGKSGGRP
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5342744-5344126 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGCGAATGAACATCACCTCGGTCGCGCTAATGTGGCTGCTCGCAGCGCAACTTGCCCAGGCCGACGACC
CGATCAACGTGTCCAAGACCGGCACGGTGCTCAGCGACGAGGTCCTCTACAGCATTGGCGGCGGCAGTGC
GGTGAGCATGGGCAGCGCCGGCCAGATGGACTCGATCGGCGTCGGCTTCGGCTGGAACAACGACATGATG
TGCGGAAACATGAACCTGAGCACCACCCTGGAGAACCAGCTCAACGGTGCCACACAGGGTTTCCAGAACA
TCATGGGCTCAGTCATCCAGAACGCGACCGGCGCGGTCATGTCGCTGCCGGCGTTGATCATCCAGCGCGC
GAACCCTCAGCTCTACAACCTGATCACCAATGGCATCCTGCAGGCGCGGATCGACTACGACCGCTCGAAA
GGGACTTGCAGAGCGATCGCCGAGAAGATGGCTGACATCGCTGGCGAGCAGACCGGCTGGGGGAAAATCG
CCGAAGGCCAGGCCCTGGGCGCCACACTGGCCTCTGACGGGAAAGACGCCGTATCCGCCCTCGAAGCAGT
GGAGAAGAAGGGCGGCAACGATGGCGTAACCTGGGTTGGTGGAGACAAGGCCGGCGGCTCCGGCCAGAAG
CCCATTCGCATCGTCAACGACGTGACCCGGGCGGGCTACAACCTGTTGACCAGCCGCTCGGTGAATGATT
CGTCGAGCGTGCCTTCCGCCACTTGCAACAACGGCCTGGTCTGCAACACTTGGTCCTCCCCCCAGGAGGC
CGCCGCATTCGCCACCCGGGTACTGGGGGAGCAACAGCAACAGACCTGCGAAGGCTGCCAGAAGACGGTG
ACGGCTGCTGGCGTCGGCCTCACCCCGCTGATCCAGGAGACCTACGACAAGAAGCTCCAGTCGCTGCAGG
AGCTGCTGTCGAAGAGCAAACCACTGACTGCAGAGAACCTGGCTGCGGCCGGCACCGATGCTCTGCCAAT
TACCCGCGGCGTCATCGAGGCGCTGCGCGACGAGCGTGACCAGGACGTCCTGGCGCGCCGCCTGGCGTCC
GATGTCTCCCTGATGGACGTGCTCAGCAAGGCACTGCTACTGCAGCGCCTGATGTTCGCCGGCGCCAAGG
AGCCCAACGTCGCCGCCAACGGCCTGGCCACCCAAGCCGTCGATCAGCAGACCAGCCTCCTGCAGCAGGA
GATCTCCAATCTCAAGACCGAACTGGAACTCCGTCGCGAGTTGGCCAGCAACTCCCCCATGCGGGTCATC
GAGCGCGGGCAACAACGCGCCTCAGGGTCCAGTGGCGTGTTCGAGTCGGCGCCCGATGCCGATCGCCTCG
ATCGCCTGCAGGCCCCCTCTGCCGCCGGCGGCAAGTCGGGAGGGAGACCGTGA
 Primer design