SecReT4
Protein ID: 116052674
T4SS name [ID]Tfc [707]
Gene symbol-
Locus tagPA14_60020
StrainPseudomonas aeruginosa UCBPP-PA14
Repliconchromosome [GenBank: NC_008463] [Browse all T4SS(s) in this replicon]
Location [Strand]5344464..5345975 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDQ02GE6
KEGG IDpau:PA14_60020
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.9e-123, Aligned region: 10..489
Protein Sequence: 503 a.a.     [Download]
>gi|116052674|ref|YP_792990.1| unnamed protein product [Pseudomonas aeruginosa UCBPP-PA14]
MTFMTNDYLEYYLTLLGWIINNGIWNMISDTGLFAVPFAAIVMREWLKVRGEGADEGNKGVLSLARIETH
IYVGYIVVALAGIPVVNVSFDTIEFDQTRAQQCQYNLPAPADTGWSSSFSSLAGKSAQMPLWWAMMHALS
KGFTSGAIAAIPCGTDLRQMRMEVDNTRVNNPLLAQEIADFSRDCYGPSRARLFMRQPDLGSVAEDNKAL
QDLNWIGSRFLLNTPGYYDTDYSKSPRQSWPYNATRDAGLPQVGGGGGYPTCKQWWADSGIGLRDRIKDQ
VDPDLMTSFLKWAKWLNQDEVTEAVIRQVISPSSQVKGNVYTDYGGQVGGTVWNGIARTAGTFGVALGSL
AYFPAMDMVRQALPMVMSFLKMAMVICIPMVLVIGTYQLKVAMTMTVVFFAMMFVDFWFQLARYIDSTIL
DAFYGSGSPHLSFNPVMGLNTATQDAILNFVMGSMFIVLPLLWMTAIGWSGIQAGSVLNGLSRGTEGVQA
AGKEAGNRVKNAV
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|116048575|ref|NC_008463.1|:5344464-5345975 Pseudomonas aeruginosa UCBPP-PA14 chromosome, complete genome
ATGACCTTCATGACCAATGACTACCTGGAGTATTACCTCACCCTCCTCGGCTGGATCATCAACAACGGGA
TCTGGAACATGATCTCGGATACTGGCCTGTTCGCGGTGCCGTTCGCGGCCATCGTGATGCGCGAATGGCT
GAAAGTTCGTGGGGAAGGCGCCGACGAGGGCAACAAGGGAGTGCTGTCTCTCGCCCGCATCGAGACGCAT
ATCTACGTCGGCTACATCGTGGTCGCCCTGGCGGGGATCCCGGTCGTCAACGTGAGCTTCGACACCATCG
AGTTCGACCAGACTCGCGCCCAGCAGTGCCAATACAATCTGCCGGCACCGGCGGACACCGGCTGGTCGAG
CTCCTTCAGCAGCCTGGCCGGCAAGAGTGCGCAGATGCCGCTCTGGTGGGCGATGATGCACGCCCTGTCC
AAGGGCTTCACCAGCGGCGCCATCGCGGCCATTCCGTGCGGCACGGATCTGCGGCAGATGCGAATGGAAG
TGGACAACACGCGCGTGAACAATCCGCTGCTGGCACAAGAAATCGCTGATTTTTCCAGAGACTGCTACGG
GCCTTCCCGTGCGCGGCTGTTCATGCGGCAACCCGACCTGGGCTCCGTCGCCGAGGACAACAAGGCGTTG
CAAGACCTGAACTGGATCGGCTCCCGATTCTTGTTGAACACCCCGGGGTACTACGACACCGACTACTCGA
AGAGTCCCCGTCAGTCGTGGCCCTACAACGCCACCCGCGATGCCGGCCTGCCTCAGGTGGGCGGTGGTGG
CGGCTACCCAACCTGCAAGCAGTGGTGGGCTGACTCAGGGATCGGCTTGCGTGATCGGATCAAGGACCAG
GTGGATCCGGACCTGATGACCAGCTTCCTCAAGTGGGCGAAATGGTTGAACCAGGACGAGGTGACCGAGG
CTGTCATTCGCCAGGTGATCTCACCCTCCAGCCAGGTCAAGGGTAACGTCTACACCGATTACGGCGGGCA
GGTGGGCGGCACCGTCTGGAACGGCATCGCGAGAACCGCAGGAACCTTCGGCGTTGCGCTGGGCAGCCTG
GCCTACTTCCCGGCGATGGATATGGTCCGCCAGGCACTGCCGATGGTGATGTCGTTCCTGAAGATGGCAA
TGGTCATCTGCATTCCGATGGTCCTGGTCATCGGCACCTATCAACTGAAAGTTGCCATGACGATGACGGT
CGTCTTCTTTGCGATGATGTTCGTCGACTTCTGGTTTCAGTTAGCCAGATATATCGACAGCACGATACTT
GATGCTTTCTATGGTTCGGGATCACCACATCTTTCATTCAACCCAGTCATGGGGCTGAATACGGCTACTC
AAGATGCGATCTTGAACTTCGTTATGGGTTCTATGTTCATTGTTTTACCACTACTGTGGATGACAGCGAT
CGGCTGGTCCGGAATTCAAGCAGGGTCTGTTCTGAACGGATTGAGCAGAGGGACTGAAGGAGTTCAAGCC
GCCGGCAAGGAAGCAGGAAATAGAGTTAAAAACGCAGTTTGA
 Primer design