SecReT4
Protein ID: 116254972
T4SS name [ID]VirB [475]
Gene symbol-
Locus tagpRL70071
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL7 [GenBank: NC_008382] [Browse all T4SS(s) in this replicon]
Location [Strand]56589..58643 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDQ1M9V4
KEGG IDrle:pRL70071
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.9e-142, Aligned region: 99..540
TraG-D_C [PF12696], Evalue: 2.3e-26, Aligned region: 393..510
TrwB_AAD_bind [PF10412], Evalue: 4.4e-21, Aligned region: 197..522
AAA_10 [PF12846], Evalue: 1.9e-06, Aligned region: 142..469
Protein Sequence: 684 a.a.     [Download]
>gi|116254972|ref|YP_770807.1| putative transmembrane conjugative DNA transfer protein [Rhizobium leguminosarum bv. viciae 3841]
MDGSTTRKLNTLLFAFLFSLTMGLLFASIYASFCRHGISRETINRFDIFSFWYETPLYVGYATPVFLRGL
TIAVSTAVITTMVGAIVILKKRNYHGTARWATRQELQRAGYIRRFRNITGPIFGKTVGPRWPGRYLTNGE
QPHSLVVAPTRAGKGVGVVIPTLLTFNGSILALDVKGELFELTSRARMARGDRVFKFAPLDSAGRTHSYN
PVLDIVNMPPERRFSETRRLAVNLIVAKGKGSEGFIEGARDLFIAGILACIERGTPTIGAVYDLFTQPGE
KYKLFAQLAEETQNQEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLIKAATTKSDFSIYDLRRDP
TSIFLCVSPNDLEVIAPLIRLFFQQVVSILQRTLPKKDEIFEVLFLLDEFKHLGKLEAIETAVTTIAGYK
GRFMFIIQSLSALTGAYEESGKENFLSNTGIQIFMATADDETPNYISKAIGDYTFRARSTSFSQRNIFDT
NIQLSDQGAPLLRSEQVRLIDDDMEIVLIKGQPPLRLKKVKYYSDRVLKRIFDNQSGALPEPEPLHLATT
YVQAPATLLVAAESLPDEAKSEDALQAALPDFAEVPVKDHAFSDFPAGGAASSDAGGKYADVEYAHDVYG
PDRVSDDHLSEEELQALAAQRALLDRIIDLQRRSNAWQTGELAPGAMHSDDHGS
 
Nucleotide Sequence: 2055 bp     [Download]
>gi|116254910|ref|NC_008382.1|:56589-58643 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL7, complete sequence
ATGGACGGGAGCACGACTCGGAAATTGAACACGCTACTGTTTGCCTTCCTTTTTTCGCTGACGATGGGGC
TTTTGTTCGCGAGTATTTATGCAAGCTTCTGTCGGCACGGCATCAGCCGCGAAACTATCAATCGCTTCGA
CATCTTCTCCTTCTGGTACGAAACGCCCCTCTATGTTGGCTACGCCACACCGGTGTTCCTCCGTGGCTTG
ACCATCGCCGTCAGTACTGCCGTAATCACTACAATGGTGGGCGCCATTGTGATTTTAAAAAAGCGGAATT
ATCATGGCACAGCGCGCTGGGCCACGCGGCAGGAACTACAGCGAGCGGGCTATATCAGGCGTTTTCGCAA
CATAACCGGACCGATCTTTGGCAAAACGGTTGGGCCGCGTTGGCCGGGTCGATATCTAACTAACGGCGAA
CAACCGCATAGTCTCGTCGTGGCCCCGACGCGCGCCGGCAAGGGCGTTGGCGTGGTCATCCCGACGCTTC
TGACCTTCAACGGTTCGATTCTGGCGCTCGACGTGAAGGGGGAGCTATTCGAGCTCACTTCGCGCGCCCG
CATGGCGCGGGGCGATCGGGTTTTCAAGTTCGCGCCACTCGACAGTGCGGGACGGACCCACAGTTACAAC
CCTGTGCTTGACATCGTCAACATGCCGCCGGAGCGCCGTTTCAGCGAGACGCGGCGGCTGGCCGTTAACT
TGATCGTTGCAAAGGGGAAGGGATCGGAAGGCTTTATTGAGGGCGCCCGAGACCTTTTTATCGCCGGCAT
ACTCGCCTGCATCGAACGCGGTACGCCGACGATCGGTGCCGTCTACGACCTATTCACCCAGCCCGGTGAG
AAATACAAGCTTTTCGCCCAGCTAGCTGAGGAAACGCAAAATCAAGAGGCACAGCGAATCTTCGATAACA
TGGCCGGTAATGATACAAAGATCCTGACTTCCTACACCTCTGTCCTTGGTGACGGCGGCCTGAATCTCTG
GGCGGACCCCTTAATCAAGGCAGCTACAACGAAGTCGGATTTTTCAATTTATGATCTCCGCCGCGATCCC
ACGTCAATTTTTCTCTGCGTTAGTCCAAACGATCTTGAGGTAATCGCCCCCCTCATTCGGCTGTTCTTCC
AGCAGGTAGTCTCCATTCTACAGCGGACACTGCCGAAGAAGGACGAAATCTTCGAGGTGCTGTTCTTGCT
GGATGAGTTTAAGCATCTCGGCAAACTCGAAGCCATAGAAACCGCGGTAACTACGATTGCTGGCTACAAG
GGGCGCTTCATGTTCATCATCCAGAGCCTCTCGGCTTTGACTGGGGCATATGAAGAGTCTGGTAAGGAGA
ATTTCCTAAGCAATACTGGCATACAGATCTTTATGGCCACTGCCGACGACGAGACTCCAAACTATATTTC
GAAAGCCATCGGCGACTATACGTTTCGCGCCCGCTCCACCTCCTTCAGCCAGCGCAACATTTTCGATACC
AATATTCAGCTTTCCGACCAGGGCGCGCCGCTGTTGCGGTCCGAGCAAGTGCGCCTCATCGACGACGACA
TGGAGATCGTGCTGATCAAAGGGCAACCGCCGCTCCGGCTAAAAAAGGTGAAATATTATTCCGACCGCGT
GCTGAAGCGGATTTTCGATAACCAGTCTGGCGCCTTGCCGGAGCCAGAACCCCTCCACCTTGCGACCACT
TACGTACAAGCGCCCGCGACGCTGCTCGTTGCCGCGGAATCGCTACCGGATGAAGCGAAATCGGAGGACG
CCTTGCAGGCCGCGTTGCCCGATTTTGCCGAGGTCCCGGTGAAAGACCACGCATTCAGCGACTTTCCGGC
GGGGGGCGCGGCCAGTTCGGATGCGGGCGGAAAATACGCTGATGTCGAATATGCGCACGACGTCTACGGA
CCGGACCGGGTCAGCGACGATCACCTGAGCGAGGAGGAACTACAGGCTCTTGCCGCCCAGCGGGCACTTC
TTGACCGGATCATCGATCTGCAGAGGCGGTCGAATGCTTGGCAAACAGGTGAACTGGCGCCAGGAGCCAT
GCACTCGGATGACCACGGTTCTTGA
 Primer design