SecReT4
Protein ID: 116255025
T4SS name [ID]VirB [475]
Gene symbol-
Locus tagpRL70134
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL7 [GenBank: NC_008382] [Browse all T4SS(s) in this replicon]
Location [Strand]110931..112412 [-]
Productputative transmembrane crown gall-like recombinase protein
Component typeVirD4
UniProt IDQ1M9Q2
KEGG IDrle:pRL70134
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.1e-125, Aligned region: 91..492
TraG-D_C [PF12696], Evalue: 4.4e-25, Aligned region: 385..478
TrwB_AAD_bind [PF10412], Evalue: 1.1e-20, Aligned region: 189..476
AAA_10 [PF12846], Evalue: 1.3e-06, Aligned region: 134..461
Protein Sequence: 493 a.a.     [Download]
>gi|116255025|ref|YP_770860.1| putative transmembrane crown gall-like recombinase protein [Rhizobium leguminosarum bv. viciae 3841]
MNTLLFAFLLSLIMGLLFASIYASFYRHGISRETINRFDIFSFWYETPLYVGYATPVFLRGLTIAVSTAV
LATMAGAVVILRKPHHHGTARWAARQELQRAGYIRPFRNITGPIFGKTVGPRWPGRYLTNGEQPHSLVVA
PTRAGKGVGVVIPTLLTFNGSILALDVKGELFEFTSRARMTRGDRVFKFAPLDSAGRTHSYNPVLDIVNM
PPERRFSETRRLAVNLIVAKGKGSEGFIEGARDLFVAGILACIERGTPTIGAVYDLFAQPGEKYKLFAQL
AGETQNQEAQRIFDNMAGNDTKILTSYTSVLGDGGLNLWADPLIKAATTTSDFSIYDLRRDPTSIFLCVS
PNDLEVIAPLIRLFFQQVVSILQRTLPKKDEIFEVLFLLDEFKHLGKLEAIETAVTTIAGYKGRFMFIIQ
SLSALTGAYEESGKENFLSNTGIQIFMATADDETPNYISKAIGDYTFRARSTSFSQRNIFDTNIQLSDQG
APR
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|116254910|ref|NC_008382.1|:c112412-110931 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL7, complete sequence
TTGAACACGCTGCTGTTTGCCTTCCTTCTTTCGCTGATAATGGGACTTTTGTTCGCGAGTATTTATGCAA
GCTTCTATCGGCACGGCATCAGCCGCGAAACTATCAATCGCTTCGACATCTTCTCCTTCTGGTACGAAAC
GCCCCTATATGTTGGCTACGCCACACCGGTGTTCCTCCGTGGCTTGACCATCGCCGTCAGTACTGCCGTA
CTCGCTACAATGGCGGGCGCCGTTGTAATCCTACGAAAGCCGCATCATCACGGCACGGCGCGCTGGGCCG
CGCGGCAGGAACTACAGCGAGCGGGCTATATCAGGCCCTTTCGCAACATAACCGGACCGATCTTTGGCAA
AACGGTTGGGCCGCGTTGGCCGGGTCGATATCTAACTAACGGCGAACAGCCGCATAGTCTCGTCGTGGCC
CCGACGCGCGCCGGCAAGGGCGTTGGCGTGGTCATCCCGACGCTTCTGACCTTCAACGGTTCAATTCTGG
CGCTCGACGTGAAGGGGGAGCTATTCGAGTTCACTTCGCGCGCCCGCATGACGCGGGGCGATCGGGTTTT
CAAGTTCGCGCCACTCGACAGTGCGGGACGGACCCACAGTTACAACCCTGTGCTTGACATCGTCAACATG
CCGCCGGAGCGCCGTTTCAGCGAGACGCGGCGGCTGGCCGTTAACTTGATCGTTGCAAAGGGGAAGGGAT
CGGAAGGCTTTATTGAGGGCGCCCGAGACCTTTTTGTCGCTGGCATACTCGCCTGCATCGAACGCGGTAC
GCCGACGATCGGTGCCGTCTACGACCTATTCGCCCAGCCCGGTGAGAAATACAAGCTTTTCGCCCAGCTA
GCTGGGGAAACGCAAAATCAAGAGGCACAGCGAATCTTCGATAACATGGCCGGTAATGATACAAAGATCC
TGACTTCCTACACCTCTGTCCTTGGTGACGGCGGCCTGAATCTCTGGGCGGACCCCTTAATCAAGGCAGC
TACAACGACGTCGGATTTTTCAATTTATGATCTCCGTCGCGATCCCACGTCAATTTTTCTCTGCGTTAGT
CCAAACGATCTTGAGGTAATCGCCCCCCTCATTCGGCTGTTCTTCCAGCAGGTGGTCTCCATTCTACAGC
GGACACTGCCGAAGAAGGACGAAATCTTCGAGGTGCTGTTCTTGCTGGATGAGTTTAAGCATCTCGGCAA
ACTCGAAGCCATAGAAACTGCGGTAACTACGATTGCTGGCTACAAGGGGCGCTTCATGTTCATCATCCAG
AGCCTCTCGGCTTTGACTGGGGCATATGAAGAGTCTGGTAAGGAGAATTTCTTAAGCAATACTGGCATAC
AGATCTTTATGGCCACTGCCGACGACGAGACTCCAAACTATATTTCGAAAGCCATCGGCGACTATACGTT
TCGAGCCCGCTCCACCTCCTTCAGCCAGCGCAACATTTTCGATACCAATATTCAGCTTTCCGACCAGGGC
GCGCCCCGGTGA
 Primer design