SecReT4
Protein ID: 116255042
T4SS name [ID]VirB [475]
Gene symboltraJ
Locus tagpRL70155
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL7 [GenBank: NC_008382] [Browse all T4SS(s) in this replicon]
Location [Strand]128392..129126 [+]
Productputative conjugative transfer protein
Component typeVirB8
UniProt IDQ1M9N5
KEGG IDrle:pRL70155
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.5e-48, Aligned region: 30..241
Protein Sequence: 244 a.a.     [Download]
>gi|116255042|ref|YP_770877.1| putative conjugative transfer protein [Rhizobium leguminosarum bv. viciae 3841]
MRQGRSTLSSFKHFKSIGVDMAKTNIQNAYEEEIFFTLRQQRNNWAKVAVGSIGAALLSLGCLLAILPLN
ETKPFVVMVDKTTGQAEKLVQVRPASLDQQDAVLQAELVSYVVDRETYDQADNSTRILDVMARSKDNAAE
TLAQLWTSNSPQYPPTIYGTGVRVRVTVKSISITPVSHRNAPDLARVRITKFREEKGRETAERSFMATLG
YSFQPKENAKLEEVWKNPLGFIVLSYRIDAETNG
 
Nucleotide Sequence: 735 bp     [Download]
>gi|116254910|ref|NC_008382.1|:128392-129126 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL7, complete sequence
ATGAGGCAGGGACGATCAACCCTTTCATCATTCAAGCATTTCAAGAGTATCGGTGTCGACATGGCCAAGA
CGAATATTCAAAACGCCTATGAGGAGGAAATATTCTTCACGCTTCGCCAGCAGCGCAACAACTGGGCGAA
AGTCGCTGTCGGCTCGATTGGCGCGGCACTCCTCTCGTTGGGGTGCCTGCTGGCAATCCTCCCGCTCAAC
GAAACCAAACCTTTTGTGGTGATGGTCGACAAGACCACCGGCCAGGCGGAAAAACTAGTGCAAGTTCGCC
CGGCCTCCCTCGATCAGCAAGATGCAGTGCTGCAGGCTGAGCTTGTATCCTATGTCGTCGACCGCGAAAC
CTACGACCAGGCCGACAACAGCACTCGCATTCTGGACGTCATGGCCCGTTCGAAGGATAATGCTGCTGAG
ACATTGGCCCAGCTGTGGACGTCCAACTCGCCACAATATCCGCCGACGATCTACGGAACAGGCGTGCGTG
TCCGGGTAACCGTAAAATCGATCTCTATCACCCCGGTTTCCCATCGCAACGCACCCGATCTCGCACGGGT
GCGTATCACTAAGTTCCGCGAGGAGAAGGGCCGAGAAACAGCCGAGCGCAGCTTTATGGCGACGTTGGGC
TATTCGTTCCAGCCGAAGGAAAATGCCAAGCTCGAGGAGGTTTGGAAGAATCCCCTCGGCTTTATCGTCC
TGTCATACCGGATCGATGCCGAAACTAACGGCTAG
 Primer design