SecReT4
Protein ID: 116255045
T4SS name [ID]VirB [475]
Gene symbol-
Locus tagpRL70158
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL7 [GenBank: NC_008382] [Browse all T4SS(s) in this replicon]
Location [Strand]131317..132318 [+]
Productputative conjugative DNA transfer/component of type IV secretion system
Component typeVirB11
UniProt IDQ1M9N2
KEGG IDrle:pRL70158
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.2e-63, Aligned region: 18..315
Protein Sequence: 333 a.a.     [Download]
>gi|116255045|ref|YP_770880.1| putative conjugative DNA transfer/component of type IV secretion system [Rhizobium leguminosarum bv. viciae 3841]
MNYVPKNREISYVEQYLSPLREFLVDDRVNELVINPNGSIFIEAAGAEYMHEIDVPLSPHAIKRLGAQLA
GDTRNTLGALHPIVSGRVMVWGHPLRVQIVVEPAIEDGVSLSIRKYLTHALATKDIGFVNGGQIRVDAQR
RRRHRAIAKMARDGDLQGLFRQAIEERFNVLVSGGTSSGKTTIARSLISMMDHNERLITIEDAQELFPPH
RNQVGLISDRKDKSARMPSKLLESCLRMRPDRIIVGEVRGVEAYDFLEAINTGHPGAITTIHADSPALAF
DRLALMVMRSGIRLTHGEVITYAKRTIDLVVQVGRLNGSRGVLEIYLPSQEEE
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|116254910|ref|NC_008382.1|:131317-132318 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL7, complete sequence
ATGAATTATGTTCCGAAGAATCGCGAAATCTCCTACGTGGAGCAATATCTGAGCCCTCTGAGAGAGTTTC
TGGTCGATGACCGCGTCAACGAGCTTGTGATCAATCCAAACGGCTCAATCTTCATCGAAGCCGCGGGTGC
CGAATACATGCACGAGATCGACGTGCCGCTGTCGCCCCATGCCATTAAGCGGCTAGGTGCGCAGCTTGCC
GGCGACACCCGCAACACACTTGGCGCCTTGCATCCGATTGTTTCCGGCCGGGTCATGGTCTGGGGGCACC
CACTGCGCGTTCAAATCGTGGTCGAACCAGCGATCGAAGACGGCGTATCGTTGTCGATCCGCAAATACTT
AACACACGCGCTGGCGACGAAGGATATCGGCTTCGTCAACGGCGGACAGATACGAGTCGATGCGCAGCGC
CGCCGCCGACACAGGGCGATTGCTAAGATGGCGCGCGACGGCGACCTGCAGGGTCTGTTCCGGCAGGCAA
TCGAGGAGAGGTTCAACGTGCTGGTATCCGGTGGCACCTCCTCGGGCAAAACAACGATCGCGCGCTCGCT
GATTTCCATGATGGACCACAATGAACGCCTGATCACCATTGAGGACGCACAGGAGCTCTTCCCACCCCAT
CGCAACCAAGTGGGGTTGATATCCGACCGGAAGGACAAGTCCGCACGGATGCCTTCCAAGCTGCTTGAAA
GCTGCCTGCGCATGCGGCCGGATCGCATCATCGTCGGAGAAGTCCGCGGCGTAGAGGCCTATGACTTTCT
CGAAGCAATCAACACCGGTCACCCTGGGGCCATTACTACCATCCATGCTGATAGCCCCGCGCTAGCATTT
GACCGCCTTGCGCTAATGGTGATGCGCTCGGGGATTAGACTTACCCATGGCGAGGTTATCACGTATGCTA
AGCGCACAATCGACTTGGTGGTTCAGGTCGGACGGCTTAATGGGTCCCGCGGGGTGCTTGAGATTTACCT
CCCTTCACAAGAGGAGGAATGA
 Primer design