SecReT4
Protein ID: 116255192
T4SS name [ID]Trb [247]
Gene symboltrbG
Locus tagpRL80135
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL8 [GenBank: NC_008383] [Browse all T4SS(s) in this replicon]
Location [Strand]139306..140136 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ1M986
KEGG IDrle:pRL80135
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 8e-59, Aligned region: 61..274
Protein Sequence: 276 a.a.     [Download]
>gi|116255192|ref|YP_771026.1| putative conjugal transfer protein TrbG [Rhizobium leguminosarum bv. viciae 3841]
MRIKHKRVALRCMLALAVSTAVSPMAIAQSLTGNEAKGTNLSGKWRGQTGLVTRGPDGKVIFLFGETQPS
VVCSPLQVCDIELQGGEIVRDVLVGDTVRWKVEPATSGAAGGQAIHLIVKPSEPGLVTSMVVTTSRRTYH
IQLKSHPTQYMARVGFEYPEDAATKLSDINARIQAMTGPDGGVAPEQLAFSYSLSGSAPWRPKRVYSDGQ
KTYIQFPRAISGQDAPVLFVVSGGQNRIVNYRMKKDMMIVDYNIDKAILISGVGWKQQKITIRRGG
 
Nucleotide Sequence: 831 bp     [Download]
>gi|116255067|ref|NC_008383.1|:c140136-139306 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence
ATGAGGATCAAACACAAACGCGTCGCTCTTCGCTGCATGCTGGCGCTTGCCGTATCGACCGCAGTTTCAC
CGATGGCCATCGCGCAAAGCCTGACGGGCAATGAGGCCAAAGGGACGAACCTCTCGGGCAAATGGCGAGG
GCAGACCGGACTGGTCACACGCGGACCGGACGGCAAGGTGATCTTCCTTTTTGGTGAGACGCAGCCCTCC
GTCGTCTGCTCCCCTTTGCAGGTCTGCGATATCGAGCTGCAGGGCGGCGAAATTGTCCGCGACGTCCTTG
TCGGTGATACCGTGCGCTGGAAGGTGGAGCCAGCAACGTCGGGCGCCGCCGGTGGACAGGCGATCCATCT
GATTGTCAAGCCGTCCGAGCCGGGGCTCGTCACTTCCATGGTGGTGACGACCTCACGCCGCACCTACCAT
ATCCAGCTGAAATCGCATCCGACTCAATACATGGCGCGGGTCGGCTTCGAATATCCCGAAGACGCCGCCA
CAAAGCTCTCCGATATCAATGCCCGCATCCAGGCTATGACCGGACCAGACGGCGGTGTCGCTCCCGAACA
GCTTGCCTTCTCCTATTCCTTGAGTGGAAGCGCACCTTGGCGGCCGAAGCGGGTCTATTCCGATGGGCAG
AAGACCTACATCCAGTTTCCGCGTGCGATCTCCGGTCAGGATGCGCCGGTTCTCTTCGTCGTCTCGGGCG
GACAAAACCGCATCGTCAATTATCGGATGAAGAAAGACATGATGATCGTCGATTACAATATCGACAAGGC
GATCCTGATTTCTGGGGTTGGCTGGAAACAGCAGAAGATCACGATCCGGCGGGGAGGGTGA
 Primer design