SecReT4
Protein ID: 116255194
T4SS name [ID]Trb [247]
Gene symboltrbL
Locus tagpRL80137
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL8 [GenBank: NC_008383] [Browse all T4SS(s) in this replicon]
Location [Strand]140836..142017 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ1M984
KEGG IDrle:pRL80137
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.3e-32, Aligned region: 64..276
Protein Sequence: 393 a.a.     [Download]
>gi|116255194|ref|YP_771028.1| putative conjugal transfer protein TrbL [Rhizobium leguminosarum bv. viciae 3841]
MVKRNRRSTILVAGIAFLALAAPAFAQQGQVLTELENQVSTAAKGWETTVMDAAKSLFWILAGIEVGIAA
VWLAIQAASLDSWFAELVRRIMFIGFFAFALTQGPTFARAVVDSLFQIGAGGGSASPAEVFDAGIRVASQ
MSEQAKFGVFEDNALAIAAVLAMGIVVICFSLVAAIFVSVMVEMYVGLLAGMIMLGLGGSSFTKDFAIRY
LVYAFGVGMKLMALVMIAKIGSNVLLGLAQAPTAESDQFITTLAIAGISVVVFIIAVYVPNIIQGVVQGA
SVSGGMETIRHGGQAASFAAGGAFLGAGAVGAGFAAAQAARAGGSSAAASVLRGMGASFSSGAMAAGSAA
KEKAIGSPGAYAGSLLGLANAKLDQARGNSSAPTPPPEKPEKP
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|116255067|ref|NC_008383.1|:c142017-140836 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence
ATGGTGAAGCGCAATCGGAGAAGCACCATCCTCGTCGCGGGAATCGCCTTCCTTGCTTTGGCGGCACCAG
CCTTCGCCCAACAAGGCCAAGTGCTGACGGAGTTGGAAAACCAGGTCTCGACTGCCGCCAAAGGGTGGGA
AACCACCGTCATGGATGCGGCGAAATCGCTGTTCTGGATCCTCGCAGGCATCGAGGTCGGCATTGCTGCG
GTGTGGCTCGCGATCCAGGCAGCATCGCTGGACAGTTGGTTTGCCGAGCTCGTCCGTCGCATCATGTTCA
TCGGCTTTTTTGCCTTCGCTTTGACGCAGGGCCCGACCTTCGCCAGGGCTGTCGTCGACAGTCTTTTCCA
AATCGGCGCCGGTGGCGGCTCTGCGTCTCCAGCCGAAGTCTTCGACGCCGGAATTCGCGTAGCGTCCCAG
ATGTCGGAACAGGCGAAGTTCGGCGTCTTCGAAGACAATGCCCTGGCTATCGCCGCCGTGCTTGCGATGG
GCATCGTCGTCATCTGCTTCTCGCTTGTCGCGGCAATCTTCGTATCGGTCATGGTCGAGATGTATGTCGG
CCTGCTGGCAGGCATGATCATGCTCGGGCTTGGCGGCTCCTCCTTCACCAAGGACTTTGCGATCCGCTAT
CTCGTCTATGCTTTCGGCGTTGGGATGAAGCTGATGGCCTTGGTCATGATCGCCAAGATCGGCTCGAACG
TCCTGCTTGGACTGGCGCAGGCCCCGACAGCCGAAAGCGACCAGTTCATCACCACACTCGCGATCGCTGG
CATTTCGGTCGTCGTCTTCATCATCGCGGTGTACGTCCCGAACATCATCCAGGGCGTCGTGCAAGGGGCG
TCGGTCTCCGGCGGCATGGAGACAATTCGCCACGGCGGACAGGCGGCCTCGTTCGCAGCGGGCGGCGCAT
TCCTTGGAGCTGGCGCCGTCGGCGCCGGTTTTGCCGCCGCGCAGGCAGCGCGGGCCGGCGGTTCCTCGGC
CGCAGCTTCGGTACTTCGGGGCATGGGCGCAAGTTTCAGCTCCGGTGCCATGGCTGCCGGATCCGCAGCC
AAGGAGAAGGCAATCGGGTCACCCGGCGCTTATGCCGGTTCCCTTCTCGGCCTGGCCAACGCAAAGCTCG
ATCAGGCTAGGGGCAATTCCTCAGCTCCGACGCCCCCTCCGGAAAAACCGGAGAAACCATAA
 Primer design