SecReT4
Protein ID: 116255198
T4SS name [ID]Trb [247]
Gene symboltrbC
Locus tagpRL80141
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL8 [GenBank: NC_008383] [Browse all T4SS(s) in this replicon]
Location [Strand]145748..146140 [-]
Productputative conjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ1M980
KEGG IDrle:pRL80141
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.2e-20, Aligned region: 5..98
Protein Sequence: 130 a.a.     [Download]
>gi|116255198|ref|YP_771032.1| putative conjugal transfer protein TrbC [Rhizobium leguminosarum bv. viciae 3841]
MQHNRFLRLGIIGALLCASLAGPALAGSGGSLPWEGPLEQIQQSITGPVAGYIALAAVAIAGGMLIFGGE
LNDFARRLMYVVLVAGILLGATTIVGLFGSTGASIGSSFVAEQPPTPSSTPLGGGEGRHG
 
Nucleotide Sequence: 393 bp     [Download]
>gi|116255067|ref|NC_008383.1|:c146140-145748 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence
ATGCAGCATAATCGCTTTCTCCGTTTGGGAATTATCGGCGCATTGCTTTGCGCCTCGCTTGCCGGGCCAG
CACTTGCAGGTTCAGGCGGAAGCCTGCCGTGGGAAGGTCCGCTCGAGCAGATCCAGCAGTCCATCACGGG
ACCGGTCGCCGGCTATATTGCACTGGCCGCCGTCGCGATTGCCGGCGGCATGCTGATCTTCGGCGGCGAG
CTCAACGATTTCGCGCGGCGACTGATGTATGTGGTACTCGTCGCGGGGATCCTGCTTGGTGCCACAACAA
TTGTCGGCCTCTTCGGTTCGACCGGTGCCTCGATCGGTAGCTCGTTTGTCGCCGAGCAACCCCCAACTCC
TTCTTCAACTCCGTTAGGGGGAGGGGAGGGGCGTCATGGCTGA
 Primer design