SecReT4
Protein ID: 116255199
T4SS name [ID]Trb [247]
Gene symboltrbB
Locus tagpRL80142
StrainRhizobium leguminosarum bv. viciae 3841
Repliconplasmid pRL8 [GenBank: NC_008383] [Browse all T4SS(s) in this replicon]
Location [Strand]146130..147095 [-]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDQ1M979
KEGG IDrle:pRL80142
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.3e-88, Aligned region: 20..286
FtsK_SpoIIIE [PF01580], Evalue: 3.1e-07, Aligned region: 135..205
AAA_19 [PF13245], Evalue: 1.7e-05, Aligned region: 135..177
DEAD [PF00270], Evalue: 7.5e-05, Aligned region: 128..184
Protein Sequence: 321 a.a.     [Download]
>gi|116255199|ref|YP_771033.1| putative conjugal transfer protein TrbB [Rhizobium leguminosarum bv. viciae 3841]
MLQSHSRLVRKLQDALGEHLCIALEDPTVVEIMLNPDGKLFIERLGHGVAPAGEMQATAAETVIGSVAHA
LQSEADGERPIISGELPIGGHRFEGLLPPVVNSPTFTIRRRASRLIPLDDYVTAKIMTEAQASIIRSAIT
NRLNIVIAGGTGSGKTTLANAVIAEIVSSAPEDRMVILEDTSEIQCAAENAVCLHTSDAVDMARLLKSTM
RLRPDRIIVGEVRDGAALTLLKAWNTGHPGGVTTIHSNSAMSALRRLEQLTSEASQQPMQAVIGEAVDLV
ISIERAGRGRRVREVLHVEGFNGSRYQTEHYPQIDEDSHAA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|116255067|ref|NC_008383.1|:c147095-146130 Rhizobium leguminosarum bv. viciae 3841 plasmid pRL8, complete sequence
ATGCTTCAGTCGCACTCCCGCCTTGTCCGTAAACTCCAAGACGCTCTCGGCGAGCACCTTTGCATTGCCC
TCGAGGATCCAACAGTCGTTGAGATCATGCTCAACCCAGATGGCAAGCTCTTCATCGAACGCCTGGGTCA
TGGTGTAGCGCCAGCTGGCGAAATGCAGGCGACCGCCGCCGAGACTGTTATCGGATCGGTAGCGCACGCT
CTCCAGTCCGAAGCCGACGGAGAACGACCGATCATCTCCGGCGAACTACCGATTGGCGGCCACCGCTTCG
AAGGCCTCCTGCCTCCCGTCGTCAACTCGCCAACGTTTACGATCCGCAGGCGCGCTTCACGGCTCATTCC
ACTCGATGACTATGTGACCGCAAAGATCATGACCGAAGCTCAGGCTTCGATCATCCGCAGTGCCATCACC
AACCGGCTGAACATCGTCATCGCTGGCGGGACGGGCTCAGGTAAGACAACACTCGCGAACGCGGTCATCG
CTGAAATCGTTTCCTCCGCGCCTGAGGACAGGATGGTGATCCTGGAGGACACGTCCGAAATCCAATGCGC
AGCGGAAAATGCCGTCTGCCTCCACACGAGCGACGCTGTCGACATGGCCAGGCTTCTCAAGAGCACGATG
CGCCTGCGTCCCGACCGCATCATCGTTGGCGAGGTTCGTGACGGGGCGGCACTGACCCTGCTGAAAGCCT
GGAACACAGGACACCCAGGAGGCGTCACGACGATCCATTCCAATTCCGCAATGTCGGCGCTTCGGCGCCT
CGAGCAACTGACATCGGAAGCCAGTCAACAGCCAATGCAAGCCGTGATTGGCGAAGCGGTCGATCTCGTC
ATCTCGATCGAACGCGCCGGGCGAGGCCGCCGGGTGAGGGAGGTCCTCCATGTCGAGGGGTTCAACGGCT
CGCGTTACCAGACAGAACACTATCCGCAGATCGATGAGGACAGTCATGCAGCATAA
 Primer design