SecReT4
Protein ID: 116687165
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6789
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]1389..1886 [+]
Productlytic transglycosylase, catalytic
Component typeOrf169_F
UniProt IDA0B4M4
KEGG IDbch:Bcen2424_6789
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 165 a.a.     [Download]
>gi|116687165|ref|YP_840411.1| lytic transglycosylase, catalytic [Burkholderia cenocepacia HI2424]
MRTFCVAVAAAIALLAAPPATADVCKGNIFNEAAALYHLDPDLLRAITWVESRGVPGAIGPRLPDGHRAW
GAAQINDIHLPELVSYGVTQRDLLNPCVNLKLSAWVLANCIQAKGATWAAVGCYNTGPGSTNIAAQARYV
RLVQRAYAGYRAQSALGKVAEGGAR
 
Nucleotide Sequence: 498 bp     [Download]
>gi|116687164|ref|NC_008545.1|:1389-1886 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGCGCACCTTCTGCGTGGCAGTTGCTGCCGCGATCGCCCTGCTCGCTGCTCCGCCAGCGACCGCGGACG
TTTGCAAGGGCAATATCTTCAATGAGGCTGCCGCCCTCTATCACCTCGATCCCGATCTCCTGCGGGCGAT
AACCTGGGTCGAATCCCGTGGCGTGCCCGGCGCCATTGGGCCGCGCTTGCCGGACGGCCACAGGGCATGG
GGGGCAGCGCAAATCAACGATATCCATCTTCCCGAGCTCGTCAGCTACGGCGTCACCCAACGCGACCTCC
TGAACCCCTGCGTGAACCTCAAGCTCAGCGCGTGGGTGCTCGCCAACTGCATCCAGGCCAAGGGCGCGAC
CTGGGCCGCCGTCGGTTGCTACAACACAGGGCCCGGTTCCACGAACATCGCCGCCCAGGCGCGCTATGTC
CGGCTGGTGCAGCGTGCATATGCGGGCTATCGCGCCCAGTCGGCGCTCGGCAAGGTCGCCGAAGGAGGCG
CGCGATGA
 Primer design