SecReT4
Protein ID: 116687168
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6792
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]3155..3766 [+]
Producthypothetical protein
Component typeTraE_F
UniProt IDA0B4M7
KEGG IDbch:Bcen2424_6792
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 2e-26, Aligned region: 1..169
Protein Sequence: 203 a.a.     [Download]
>gi|116687168|ref|YP_840414.1| hypothetical protein Bcen2424_6792 [Burkholderia cenocepacia HI2424]
MTPGKAAQSREQLQSENRFLKKVLLGNGTTSVVIALTCAWLVITQRVIIMPPAVRGTYVIGARYANDQYL
ADQAAYVLALSKSVTPTTVDNNVRILLSMVDDDRRAALKTEWEADALQIKHDGVTNVFEPMGVGEVDFRN
KAVKVTGTLTTYISGKRTSSEQKTYEVYFGITVFGRLVLLDIREATRGKQGVEPLVTTETPAS
 
Nucleotide Sequence: 612 bp     [Download]
>gi|116687164|ref|NC_008545.1|:3155-3766 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGACACCCGGTAAAGCCGCCCAATCACGCGAACAGCTGCAGTCCGAGAACCGCTTTCTGAAGAAAGTGC
TGCTCGGGAACGGCACCACCAGTGTGGTCATAGCCCTCACCTGCGCATGGCTGGTCATCACGCAGCGCGT
CATCATCATGCCGCCAGCCGTTCGCGGCACCTACGTCATCGGGGCCCGGTATGCGAACGACCAGTACCTC
GCCGATCAGGCCGCGTACGTGCTCGCCCTTTCCAAAAGCGTCACGCCGACCACCGTCGACAACAACGTAC
GGATTCTCCTGTCCATGGTCGATGACGATCGGCGCGCCGCGCTCAAGACCGAATGGGAGGCCGACGCGCT
GCAGATCAAGCACGACGGCGTGACGAACGTCTTCGAGCCGATGGGGGTAGGTGAGGTGGACTTCCGCAAC
AAGGCCGTGAAGGTCACCGGCACCTTGACCACCTACATCTCCGGCAAACGCACGAGCTCGGAACAAAAGA
CCTACGAGGTCTATTTCGGAATCACCGTCTTCGGCCGCTTGGTCCTCCTCGACATCCGAGAAGCCACGCG
CGGCAAACAAGGCGTCGAGCCGCTGGTCACAACGGAGACTCCCGCATCATGA
 Primer design