SecReT4
Protein ID: 116687169
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6793
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]4030..4509 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDA0B4M8
KEGG IDbch:Bcen2424_6793
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 5.4e-20, Aligned region: 9..151
Protein Sequence: 159 a.a.     [Download]
>gi|116687169|ref|YP_840415.1| hypothetical protein Bcen2424_6793 [Burkholderia cenocepacia HI2424]
MPANPTALNESITVFVIDDAGTTYRLLLVPGPRPAEDVRIEPPAARSTQALQASAFQRRVKLMMLAMAGG
RGAPQLSYTSLDTVVPLWKEAVLTLVRQYSDGDFIGETYTLSNTSHTDMAIDERELYAPGVLAIAIENAN
LPAGASTIVYVVRERGDHE
 
Nucleotide Sequence: 480 bp     [Download]
>gi|116687164|ref|NC_008545.1|:4030-4509 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGCCCGCGAATCCCACCGCGCTGAATGAGTCGATCACGGTGTTCGTGATCGATGACGCTGGCACCACCT
ACCGTTTGTTGCTCGTACCTGGTCCGCGACCGGCCGAAGATGTCCGTATCGAACCGCCTGCAGCGCGCTC
GACCCAGGCGCTCCAAGCATCGGCCTTTCAACGACGGGTGAAGCTCATGATGCTGGCGATGGCCGGTGGT
CGGGGGGCACCGCAGCTGTCGTACACGTCGCTCGACACTGTCGTGCCGCTCTGGAAGGAGGCTGTATTGA
CGCTGGTCCGTCAGTACAGCGACGGCGATTTCATTGGCGAGACGTACACGCTCTCGAATACCTCGCACAC
TGACATGGCTATCGACGAGCGCGAACTCTACGCGCCGGGCGTGCTCGCCATCGCAATCGAAAACGCAAAC
CTGCCGGCCGGCGCCAGCACGATCGTCTATGTCGTTCGTGAGCGGGGCGACCATGAGTGA
 Primer design