SecReT4
Protein ID: 116687170
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6794
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]4502..5824 [+]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDA0B4M9
KEGG IDbch:Bcen2424_6794
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 9.8e-36, Aligned region: 213..410
Protein Sequence: 440 a.a.     [Download]
>gi|116687170|ref|YP_840416.1| TraB pilus assembly family protein [Burkholderia cenocepacia HI2424]
MSDVNQATKRRQRILTVAGFAVLAGLFAVGMFFTQSGPANRQFTTKVPFTSLGDQNDRNAWRAHSEAQLA
ELTRRMSSIDSRADDAVSQMKALSKAQDELSKRIDAMKSTPASAPAPASGATSDRAALDKPIPLNGAPAK
TGAILNPPFGKSGKPGVDMAAAPPKLAIIQFNTPTGNGADCVDPRYSSLPLDQATRAQQDCLKANGKKKI
SFIPGSSFVRVFMMNGVDAPTGGEAQHDPLPVFLQVLDPANLPNSRKLDITECRILTQAYGDVSSERTHM
RGETLDCILKNGRTVEMPIKGNVMGEDGKEGVRGRLVSKAGSALAMSVFAGISSGIGQAFNQSANTLSNT
ALGSTSIINPSQVGRAAIGSGVSGGADALKQYYIRTAEKLFPVIETDGGRIVEFAVTKGAEYDGALSDIS
NINDGLANDGRANDGGYSDD
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|116687164|ref|NC_008545.1|:4502-5824 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGAGTGATGTCAATCAAGCAACCAAGCGCCGCCAGCGGATCCTGACCGTGGCCGGTTTCGCCGTCCTCG
CTGGCCTCTTCGCCGTTGGTATGTTCTTCACGCAGAGCGGGCCGGCCAATCGTCAGTTCACCACGAAGGT
GCCGTTTACGAGCCTCGGCGACCAGAACGATCGCAATGCCTGGCGGGCTCACTCCGAGGCGCAACTCGCT
GAGCTTACGCGCAGGATGTCGAGTATAGATTCGCGCGCCGACGATGCCGTGTCGCAGATGAAAGCCTTGT
CGAAAGCCCAGGACGAGCTCAGTAAGCGGATCGACGCGATGAAGAGCACGCCGGCAAGCGCGCCCGCGCC
CGCGTCCGGAGCAACCTCAGACCGCGCGGCCCTGGACAAGCCAATTCCCCTCAACGGGGCCCCGGCCAAG
ACGGGCGCAATCCTGAATCCGCCATTCGGCAAATCCGGCAAGCCCGGTGTCGATATGGCTGCTGCCCCTC
CAAAGCTCGCCATCATTCAATTCAATACACCGACCGGCAACGGGGCCGACTGCGTCGACCCCCGCTACTC
GTCGTTGCCGTTGGATCAGGCGACACGTGCACAGCAGGACTGCCTGAAGGCCAACGGCAAGAAGAAAATC
AGCTTCATCCCGGGCTCCTCATTTGTTCGCGTATTCATGATGAACGGTGTCGACGCCCCAACGGGCGGTG
AGGCGCAGCACGACCCGCTTCCCGTGTTCCTCCAGGTATTGGACCCAGCCAATCTGCCGAACAGCCGGAA
GCTCGACATCACGGAGTGCCGGATTCTGACGCAGGCGTATGGCGATGTGTCCAGCGAGCGCACTCACATG
CGCGGCGAAACGCTCGACTGCATCTTGAAGAACGGCCGAACCGTGGAAATGCCGATCAAGGGCAACGTGA
TGGGCGAGGACGGCAAGGAGGGTGTGCGAGGTCGGCTCGTCTCGAAGGCGGGATCGGCATTGGCCATGTC
GGTGTTCGCCGGTATCTCGTCCGGGATTGGGCAAGCGTTCAATCAGTCCGCCAACACCCTCAGTAATACC
GCCCTTGGGTCCACCTCCATTATCAATCCGAGCCAGGTCGGCCGTGCTGCTATCGGCAGTGGCGTCTCTG
GAGGCGCCGACGCTCTTAAGCAGTACTACATCCGCACGGCTGAGAAGCTTTTCCCCGTGATCGAAACGGA
CGGTGGCCGCATTGTCGAGTTCGCCGTGACAAAGGGAGCCGAATACGACGGCGCCCTCTCCGATATCAGC
AACATCAACGATGGCTTGGCCAACGATGGCCGTGCTAACGATGGGGGCTACTCCGATGATTGA
 Primer design