SecReT4
Protein ID: 116687176
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6800
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]9057..9737 [+]
Producthypothetical protein
Component typeTraV_F
UniProt IDA0B4N5
KEGG IDbch:Bcen2424_6800
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2.3e-29, Aligned region: 27..150
Protein Sequence: 226 a.a.     [Download]
>gi|116687176|ref|YP_840422.1| hypothetical protein Bcen2424_6800 [Burkholderia cenocepacia HI2424]
MKNKIMLATLSALLTLTGCSFSGYDASSQFACKAPEGVLCSSMSGIYANAMAHNLPDQRVHTGAGATTNI
ALGSYAGDFSQASSAPGAAVGGNARPVVGAAGILPKALDSGAPVHTASREMRIWFAPWQDADSDLHDQEY
VYLIVDPGHWSIAHNQQRIQAAFRPVMPPTAASDADSSGSKASAASSNTESASGSISSADRVMQGILTPA
GAVDRAAAAMPAATDH
 
Nucleotide Sequence: 681 bp     [Download]
>gi|116687164|ref|NC_008545.1|:9057-9737 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGAAAAACAAGATCATGCTGGCCACGCTTTCCGCGCTTCTCACCCTGACCGGCTGCAGCTTCAGCGGCT
ATGACGCGAGCTCGCAATTCGCCTGCAAGGCGCCTGAAGGGGTGCTCTGCAGCAGCATGTCTGGCATCTA
TGCCAACGCGATGGCGCATAACCTGCCCGACCAGCGCGTGCATACAGGCGCCGGCGCGACGACGAATATC
GCGCTCGGCAGCTATGCCGGAGATTTCAGCCAGGCATCGAGCGCACCGGGTGCTGCGGTCGGCGGCAATG
CTCGACCCGTCGTCGGCGCCGCCGGGATTCTCCCCAAAGCGCTCGACAGCGGTGCTCCGGTTCACACGGC
GTCGCGCGAGATGCGGATCTGGTTCGCACCGTGGCAGGACGCGGACTCGGACTTGCACGATCAGGAATAC
GTCTATCTGATCGTCGATCCCGGCCACTGGTCGATCGCGCACAACCAGCAGCGCATCCAGGCCGCGTTCC
GGCCGGTGATGCCGCCGACAGCTGCGTCGGATGCTGACAGTAGCGGTAGCAAGGCATCCGCTGCTAGCTC
CAACACCGAGTCGGCGTCGGGGTCGATCTCGAGTGCCGATCGGGTCATGCAGGGAATTCTCACGCCTGCC
GGTGCAGTCGACCGTGCAGCGGCTGCGATGCCCGCAGCGACAGACCACTGA
 Primer design