SecReT4
Protein ID: 116687177
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6801
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]9752..12346 [+]
Producthypothetical protein
Component typeTraC_F
UniProt IDA0B4N6
KEGG IDbch:Bcen2424_6801
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7e-50, Aligned region: 47..291
AAA_10 [PF12846], Evalue: 1.9e-48, Aligned region: 490..779
Protein Sequence: 864 a.a.     [Download]
>gi|116687177|ref|YP_840423.1| hypothetical protein Bcen2424_6801 [Burkholderia cenocepacia HI2424]
MSTLQAWIDDAKSLARTAISEAILGTEDDLGPPAPVAADQRRVETVGLHNLLPYDQYDPATELYYNTDSV
GFVLAVAPQTGADAELTRSLHGLYDSVPAGYGLQWMLLGDPIIEESLNAYVDLRREYAEAGRAPSFYLEQ
AERRAAFIRGKLGQPLFLGQNYSITDKRLLLSIVRKGSLDDLKLIEEIQNIRDVVGATLSSASLASRTAE
PDDLKRFLWPILNPSAFFGDGAETIDQTYSDDKPIRDQLTAFGHHMRVKAKHLLYGVPPEDADEPDARIA
VRSFGVHQYPKSKELWEMNNIVGSLFNDVHQYPCPYLITLGVLILDQTAVETRAALRGARATQNAESKIA
KLQPELALQNQDWKAVSMQLTQGGSMCELYHTLTLFAPRKKMEQCVAAAKGIWRSERFKLFPMLTQQLTT
FLSALPMMLTSDMRDDLKKFRLITTKTTVNATDMAPVLGEWSGTSGRANLLFFGRRGTPALVDIYSSGTN
YNGFVDGTSGAGKSVLLNEIIGAFRSVGGIVRICDVGYSYEKQIDMGDGQYIDFKPGSRIIINAFSTAGI
DTENGLDSEVKFIRPIIARMVSPTAPITPFEGALLDVAVRIVWKDYGQEGSPTLVRDALLSLKDQNGQPE
RIAYELAVRLEPFCKGGVYGDYVNGRTNVSLDNEVVGLELEHLNSDPQLRTVIMLGLTNQVTNEMYRFDR
SRPKLFLQDEGWQIVGDDQESADFMEEGYRRARKYEGSFFFATQGITDAGMNKATQAAFDNSAWKFHLKQ
SDDTLKKIEKGDVMDLSPGLKRMLKSLRPVPGRYSEFVLVDPNGGTHLLRHIPDEFTLAMATTKGPDYEF
MERLRTSGTSTEDAIRALIQAKRK
 
Nucleotide Sequence: 2595 bp     [Download]
>gi|116687164|ref|NC_008545.1|:9752-12346 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGAGCACCCTGCAGGCCTGGATCGACGACGCGAAATCGCTCGCGCGAACAGCGATCAGCGAAGCAATCC
TCGGCACCGAGGACGACCTCGGGCCACCCGCCCCCGTCGCTGCCGACCAGCGGCGCGTCGAGACAGTCGG
ACTTCATAACCTGCTGCCGTATGACCAGTACGACCCCGCCACGGAGCTCTACTACAACACGGATTCCGTT
GGCTTCGTGCTTGCAGTTGCACCGCAGACGGGCGCTGACGCGGAGTTGACCCGCAGTCTCCACGGCCTAT
ATGACTCGGTTCCTGCCGGCTATGGGCTTCAATGGATGCTGCTGGGCGACCCCATCATCGAGGAGTCGTT
AAACGCCTACGTCGACTTGCGGCGCGAGTACGCCGAGGCGGGCCGTGCACCCTCGTTCTATCTGGAGCAG
GCCGAGCGCCGCGCCGCGTTCATCCGCGGCAAACTCGGCCAGCCGCTGTTTCTGGGCCAAAACTACTCGA
TCACGGACAAGCGGCTGTTGCTGTCGATCGTGCGCAAGGGCTCGCTCGACGATCTGAAGCTGATCGAAGA
AATCCAGAATATTCGCGACGTCGTCGGCGCGACGCTGAGTTCCGCAAGCCTGGCAAGCCGTACTGCGGAG
CCCGACGATCTGAAGCGCTTTCTCTGGCCGATCCTCAACCCCAGTGCGTTCTTTGGCGATGGAGCTGAGA
CGATCGATCAGACCTACAGCGACGACAAGCCCATTCGTGACCAACTGACGGCTTTCGGTCACCACATGCG
TGTGAAGGCGAAGCATTTGCTCTATGGAGTGCCGCCCGAGGATGCGGACGAGCCCGACGCACGCATCGCG
GTGCGCAGCTTTGGCGTGCACCAGTATCCGAAGAGCAAAGAGCTCTGGGAGATGAACAACATCGTAGGTT
CACTCTTCAACGATGTCCATCAATACCCCTGCCCGTACCTGATCACGCTCGGCGTCCTGATTCTCGATCA
GACCGCCGTCGAGACACGGGCCGCTCTGCGTGGTGCTCGCGCGACACAGAACGCCGAGTCGAAAATCGCG
AAGCTGCAGCCGGAACTCGCCCTGCAGAACCAGGACTGGAAAGCCGTCTCGATGCAGCTCACGCAAGGTG
GCTCGATGTGTGAGCTCTATCACACGCTGACGCTCTTCGCTCCGCGCAAAAAGATGGAGCAGTGTGTGGC
GGCCGCGAAAGGAATCTGGCGCTCGGAGCGCTTCAAGCTGTTCCCGATGCTGACCCAGCAGCTTACGACG
TTCCTGTCGGCCCTGCCCATGATGCTGACAAGCGACATGCGGGACGACCTCAAGAAGTTCCGGTTGATCA
CTACCAAGACCACCGTGAATGCGACCGACATGGCGCCGGTGCTGGGCGAATGGTCGGGTACCAGTGGACG
AGCCAATCTGCTGTTCTTTGGGCGCCGCGGTACGCCCGCGCTCGTAGACATCTACTCGAGCGGAACGAAC
TACAACGGCTTTGTGGATGGTACTTCCGGCGCCGGTAAATCGGTACTTCTGAACGAGATTATCGGAGCGT
TTCGCTCGGTCGGCGGAATCGTCCGGATCTGCGATGTGGGCTACTCGTATGAAAAGCAGATCGACATGGG
CGACGGCCAGTACATCGACTTCAAGCCCGGGTCGCGAATCATCATCAATGCGTTTTCGACGGCCGGTATC
GATACCGAAAATGGCCTCGACAGCGAGGTGAAATTCATCCGGCCGATTATCGCGCGCATGGTATCGCCGA
CCGCACCCATCACCCCGTTCGAGGGTGCGTTGCTCGATGTCGCAGTGCGCATCGTATGGAAGGACTACGG
TCAGGAAGGTAGTCCCACGTTGGTGCGGGACGCCTTGTTGAGCCTGAAGGACCAGAACGGGCAACCCGAA
CGCATCGCGTATGAGCTTGCCGTGCGTCTCGAACCGTTCTGCAAGGGCGGTGTTTACGGCGACTACGTCA
ACGGGCGCACCAACGTAAGCCTCGATAACGAAGTGGTGGGCCTTGAACTCGAGCACCTCAACAGCGATCC
CCAACTGCGCACGGTGATCATGCTCGGCCTGACCAATCAGGTCACCAACGAAATGTACCGCTTTGACCGG
TCGCGGCCGAAGCTATTCCTGCAGGACGAGGGCTGGCAGATCGTCGGTGACGATCAAGAGTCGGCCGACT
TCATGGAAGAAGGCTATCGGCGTGCGCGCAAATATGAAGGCAGCTTCTTTTTCGCGACGCAGGGGATCAC
CGATGCGGGGATGAACAAGGCTACGCAGGCCGCCTTCGACAACTCCGCATGGAAGTTCCACCTCAAGCAA
AGCGACGACACGCTCAAGAAGATCGAGAAGGGCGATGTGATGGATCTGTCACCGGGGCTGAAGCGCATGT
TGAAGTCGCTGCGCCCGGTACCCGGTCGCTATAGCGAGTTCGTCCTTGTCGATCCGAACGGAGGCACTCA
CCTGCTGCGCCATATCCCCGACGAATTCACTCTGGCCATGGCAACCACCAAGGGGCCGGACTACGAATTC
ATGGAGCGGTTGCGTACCAGCGGCACTTCGACCGAAGACGCCATCCGCGCCCTGATCCAAGCCAAACGGA
AATGA
 Primer design