SecReT4
Protein ID: 116687180
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6804
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]13734..14375 [+]
Producthypothetical protein
Component typeTraW_F
UniProt IDA0B4N9
KEGG IDbch:Bcen2424_6804
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 1.2e-10, Aligned region: 6..36
Protein Sequence: 213 a.a.     [Download]
>gi|116687180|ref|YP_840426.1| hypothetical protein Bcen2424_6804 [Burkholderia cenocepacia HI2424]
MRRPAVTWIAALTLAASPISAVADDLGVVGPTYPIAEHDAIVMLKRRLLELRANGGLATVERRARQRALH
DVTSLPPVPGISTVSEYSSRLIDPTVTYAKPVTNDEGAVIVAAGTRINPLDIVTLHERLVFFDGRDPAQV
KAVQALASRSGDSIKPILTAGSWFDLTKSWKRQVYFDQQGRLSQRFGITRVPAVISQRGNQLLLEEEPAE
QLR
 
Nucleotide Sequence: 642 bp     [Download]
>gi|116687164|ref|NC_008545.1|:13734-14375 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
GTGCGACGCCCGGCCGTCACGTGGATCGCGGCATTGACGCTCGCGGCATCCCCAATCTCCGCGGTCGCGG
ACGACTTGGGCGTGGTTGGCCCGACGTATCCGATCGCAGAGCATGACGCAATTGTGATGTTGAAGCGTCG
CCTGCTCGAACTGCGAGCCAATGGTGGGCTGGCGACCGTCGAGCGCCGCGCACGTCAGCGCGCGCTGCAT
GACGTCACGTCCCTGCCCCCGGTGCCGGGCATTTCAACCGTCAGCGAGTACTCGAGTCGCCTGATCGATC
CGACGGTCACGTACGCAAAACCCGTCACCAATGACGAGGGCGCCGTGATTGTCGCCGCCGGCACGCGTAT
CAATCCGCTCGACATTGTCACGTTGCACGAGCGCCTGGTGTTCTTCGACGGCCGTGATCCGGCTCAGGTT
AAGGCGGTTCAGGCGCTCGCGTCCCGCTCCGGCGATTCCATCAAACCGATCCTGACTGCTGGTTCGTGGT
TTGACCTGACGAAGTCGTGGAAACGGCAAGTGTATTTCGATCAGCAGGGTCGACTTAGCCAGCGTTTCGG
GATCACCCGCGTGCCGGCCGTCATCAGCCAGCGCGGCAACCAACTGCTTCTCGAGGAAGAACCTGCGGAG
CAACTGCGTTGA
 Primer design