SecReT4
Protein ID: 116687182
T4SS name [ID]Tra_F [516]
Gene symbol-
Locus tagBcen2424_6806
StrainBurkholderia cenocepacia HI2424
Repliconplasmid 1 [GenBank: NC_008545] [Browse all T4SS(s) in this replicon]
Location [Strand]15111..16142 [+]
ProductTraU family protein
Component typeTraU_F
UniProt IDA0B4P1
KEGG IDbch:Bcen2424_6806
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 2.9e-78, Aligned region: 35..334
Protein Sequence: 343 a.a.     [Download]
>gi|116687182|ref|YP_840428.1| TraU family protein [Burkholderia cenocepacia HI2424]
MSMGPLLRRWILAIALVASCFSFSAPADAGQCVGRFANPITDICWECAFPMAIGSVTFLNMGQDDTPNPG
GFLCFCNGTFGVKFSFWEPIRRVDVTRSPYCFVSLGGISLNPGIHAPEGEVREQKDDTKQSFYQVHWYTD
PVMYYTEILLDDPCMETGSFDVAYMTEVDPTWSDDDLTMLLEPETYLFGSPIAQAACAGDCVLSSLGFGS
NLLFWCAGCNGSIYPFNGHVQAHVSAIQASSLLVERMTAKLHREGLMWGTTGDGAMCGYYLQPVMDKTQY
KYTMLYPVAQTDQINGQCCQPYGRTSALWGAGKMIPYTGEDFAYEIFRKRNCCMGANLGDLRQ
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|116687164|ref|NC_008545.1|:15111-16142 Burkholderia cenocepacia HI2424 plasmid 1, complete sequence
ATGAGCATGGGCCCTCTCCTTCGCCGCTGGATTCTCGCGATCGCGCTGGTTGCCAGCTGCTTCTCGTTCT
CGGCGCCGGCCGATGCGGGTCAGTGTGTCGGCCGATTCGCCAATCCGATCACGGATATCTGCTGGGAATG
CGCTTTCCCGATGGCCATTGGTAGCGTCACGTTCCTCAATATGGGCCAGGACGACACCCCGAACCCGGGA
GGATTCCTCTGCTTCTGTAACGGCACGTTCGGCGTCAAGTTCAGCTTCTGGGAGCCGATCCGGCGCGTCG
ACGTCACGCGCTCGCCCTACTGCTTCGTGTCGCTCGGCGGGATCTCGCTGAACCCGGGCATCCACGCCCC
GGAGGGGGAGGTGCGCGAGCAGAAGGACGACACCAAGCAGAGCTTCTATCAGGTGCACTGGTACACCGAT
CCGGTCATGTACTACACCGAGATCCTGCTAGACGACCCCTGTATGGAGACGGGCAGCTTCGATGTCGCGT
ACATGACCGAAGTCGATCCGACGTGGAGCGACGACGATCTCACCATGCTCCTCGAGCCCGAGACCTACCT
GTTCGGCAGTCCGATCGCCCAGGCCGCGTGCGCAGGTGACTGCGTACTCTCGAGCCTAGGTTTCGGCAGC
AACCTGCTCTTCTGGTGCGCAGGCTGCAACGGCTCGATCTATCCATTCAACGGCCACGTTCAGGCTCATG
TGTCCGCGATCCAGGCGTCGTCACTGCTGGTCGAGCGCATGACCGCAAAGCTGCATCGCGAGGGTTTGAT
GTGGGGCACGACAGGTGACGGGGCCATGTGCGGCTACTACCTGCAGCCGGTGATGGACAAGACCCAATAC
AAGTACACGATGCTCTACCCCGTTGCGCAAACCGACCAGATCAACGGTCAGTGCTGTCAGCCGTATGGCC
GCACGTCGGCGCTCTGGGGCGCCGGAAAAATGATCCCGTACACGGGGGAGGACTTCGCGTACGAGATTTT
CCGCAAGCGCAACTGCTGCATGGGTGCGAACCTCGGAGACCTGCGCCAATGA
 Primer design